Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Secukinumab Biosimilar – Anti-IL17A mAb – Research Grade

  • PX-TA1234-50
  • Validated ELISA
Isotype:
IgG1, kappa

Original price was: $129.00.Current price is: $100.00.

50ug 22% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade

Product name Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1234-50
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

Introduction to Secukinumab Biosimilar – Anti-IL17A mAb

Secukinumab Biosimilar, also known as Anti-IL17A mAb, is a research grade antibody that specifically targets the cytokine Interleukin 17A (IL-17A). This biosimilar is a promising therapeutic option for various inflammatory diseases, as it has shown to effectively block the activity of IL-17A, which plays a crucial role in immune responses and inflammation. In this article, we will explore the structure, activity, and potential applications of Secukinumab Biosimilar.

Structure of Secukinumab Biosimilar

Secukinumab Biosimilar is a monoclonal antibody (mAb) that is produced using recombinant DNA technology. It is a humanized IgG1 antibody that is composed of two heavy chains and two light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab regions are responsible for binding to the IL-17A cytokine, while the Fc region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Secukinumab Biosimilar

Secukinumab Biosimilar binds to IL-17A with high affinity and specificity, preventing it from binding to its receptor on the surface of immune cells. IL-17A is a pro-inflammatory cytokine that is produced by various immune cells, including T cells, and is involved in the pathogenesis of several inflammatory diseases. By blocking IL-17A, Secukinumab Biosimilar inhibits the downstream signaling pathways that lead to inflammation and tissue damage. This results in a reduction of symptoms and disease progression in patients with IL-17A-mediated diseases.

Title: Therapeutic Targets of Secukinumab Biosimilar

Secukinumab Biosimilar has been studied as a potential treatment for a variety of inflammatory diseases, including psoriasis, psoriatic arthritis, ankylosing spondylitis, and rheumatoid arthritis. These diseases are characterized by an overproduction of IL-17A, which leads to chronic inflammation and tissue damage. By targeting IL-17A, Secukinumab Biosimilar has shown to be effective in reducing symptoms and improving quality of life in patients with these conditions.

Title: Applications of Secukinumab Biosimilar

Psoriasis is a chronic skin disease that affects millions of people worldwide. It is characterized by red, scaly patches on the skin, which can be itchy and painful. IL-17A is known to play a major role in the development of psoriasis, and Secukinumab Biosimilar has been approved for the treatment of moderate to severe plaque psoriasis. It has also shown to be effective in treating psoriatic arthritis, a type of arthritis that affects some people with psoriasis.

Ankylosing spondylitis is a type of arthritis that primarily affects the spine and can lead to stiffness, pain, and fusion of the vertebrae. IL-17A has been implicated in the pathogenesis of this disease, and Secukinumab Biosimilar has shown to improve symptoms and slow disease progression in patients with ankylosing spondylitis.

Rheumatoid arthritis is a chronic autoimmune disease that causes inflammation and damage to the joints. IL-17A has been found to play a role in the progression of rheumatoid arthritis, and Secukinumab Biosimilar has shown to be effective in reducing symptoms and slowing down joint damage in patients with this condition.

Conclusion

In conclusion, Secukinumab Biosimilar is a promising therapeutic option for various inflammatory diseases, as it specifically targets the cytokine IL-17A and inhibits its activity. This research grade antibody has a well-defined structure and has shown to be effective in clinical trials for the treatment of psoriasis, psoriatic arthritis, ankylosing spondylitis, and rheumatoid arthritis

SDS-PAGE for Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade

SDS-PAGE for Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade

Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Secukinumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Secukinumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Secukinumab Biosimilar - Anti-IL17A mAb (cat. No.PX-TA1234) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Secukinumab Biosimilar – Anti-IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products