Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Secukinumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Secukinumab ELISA Kit

Secukinumab ELISA Kit

Product name Secukinumab ELISA Kit
Uniprot ID Q16552
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX261
Note For research use only.
Sample type Plasma, Serum
Target Secukinumab
Immunogen Secukinumab

Introduction

Secukinumab is a monoclonal antibody that has been developed as a therapeutic agent for the treatment of various autoimmune diseases. It specifically targets interleukin-17A (IL-17A), a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of autoimmune diseases such as psoriasis, psoriatic arthritis, and ankylosing spondylitis. The measurement of Secukinumab levels in patient samples is important for monitoring treatment efficacy and optimizing dosing. This is made possible by the use of a Secukinumab ELISA kit, which provides a sensitive and specific method for the quantitative determination of Secukinumab levels in biological samples.

Structure of Secukinumab

Secukinumab is a fully human monoclonal antibody of the IgG1 subclass. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 50 kDa. The antibody is produced by recombinant DNA technology in Chinese hamster ovary (CHO) cells. The heavy and light chains are linked by disulfide bonds and the antibody has a typical Y-shaped structure. The variable regions of the antibody are responsible for binding to the target antigen, IL-17A.

Activity of Secukinumab

Secukinumab acts by specifically binding to IL-17A and inhibiting its interaction with the IL-17 receptor. This prevents the downstream signaling cascade that leads to the production of pro-inflammatory cytokines, chemokines, and other mediators of inflammation. In addition, Secukinumab also promotes the clearance of IL-17A by binding to it and facilitating its removal from the circulation. This dual mechanism of action makes Secukinumab a highly effective therapeutic agent for the treatment of autoimmune diseases.

Application of Secukinumab ELISA Kit

The Secukinumab ELISA kit is a valuable tool for measuring Secukinumab levels in patient samples. It is a sandwich enzyme-linked immunosorbent assay (ELISA) that utilizes two specific antibodies for the detection and quantification of Secukinumab. The first antibody is coated onto the surface of microtiter plates and captures the Secukinumab present in the sample. The second antibody, conjugated to an enzyme, binds to the captured Secukinumab and produces a colorimetric signal that is directly proportional to the amount of Secukinumab present in the sample. The kit is highly sensitive and can detect Secukinumab levels as low as 0.1 ng/mL.

The Secukinumab ELISA kit has a wide range of applications in clinical research and drug development. It is used for monitoring the pharmacokinetics of Secukinumab in patient samples, which is important for optimizing dosing and ensuring treatment efficacy. In addition, the kit is also used in preclinical studies to determine the pharmacokinetics of Secukinumab in animal models. This is essential for predicting the efficacy and safety of Secukinumab in humans.

Conclusion

In conclusion, Secukinumab is a highly effective therapeutic agent for the treatment of autoimmune diseases. Its specific targeting of IL-17A makes it a promising therapeutic target for a wide range of autoimmune diseases. The Secukinumab ELISA kit is a valuable tool for measuring Secukinumab levels in patient samples, enabling the monitoring of treatment efficacy and optimization of dosing. With its high sensitivity and specificity, the Secukinumab ELISA kit is an essential tool for clinical and preclinical research in the field of autoimmune diseases.

Secukinumab ELISA Kit

There are no reviews yet.

Be the first to review “Secukinumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products