Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

beta-nerve growth factor(NGF)

  • PX-P4646-50
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Dog
Uniprot ID:
A0A3Q7RVL5
Molecular weight:
51.9kDa

Original price was: $355.00.Current price is: $308.00.

50ug 13% OFF + 308 loyalty points
Met1–Gly238 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

beta-nerve growth factor(NGF)

Product name PX-P4646-1MG
Uniprot ID A0A3Q7RVL5
Uniprot link https://www.uniprot.org/uniprot/A0A3Q7RVL5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MSMLFYTLITALLIGIRAEPHPESHVPAGHAIPHAHWTKLQHSLDTALRRARSAPAGAIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADAQDLDLEAGSTASVNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPTPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAG
Molecular weight 51.9kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly238
Protein Accession XP_025850472
Spec:NCBI Gene Aliases NGF
NCBI Reference XP_025850472
Reference PX-P4646
Note For research use only.
Molecular Constructor
Met1–Gly238 Fc
Product name beta-nerve Growth Factor proteins(NGF)
Uniprot ID A0A3Q7RVL5
Uniprot link https://www.uniprot.org/uniprot/A0A3Q7RVL5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MSMLFYTLITALLIGIRAEPHPESHVPAGHAIPHAHWTKLQHSLDTALRRARSAPAGAIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADAQDLDLEAGSTASVNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPTPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAG
Molecular weight 51.9kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly238
Protein Accession XP_025850472
Spec:NCBI Gene Aliases NGF
NCBI Reference XP_025850472
Reference PX-P4646
Note For research use only
Molecular Constructor
Met1–Gly238 Fc
Product name beta-nerve Growth Factor proteins(NGF)
Uniprot ID A0A3Q7RVL5
Uniprot link https://www.uniprot.org/uniprot/A0A3Q7RVL5
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence MSMLFYTLITALLIGIRAEPHPESHVPAGHAIPHAHWTKLQHSLDTALRRARSAPAGAIAARVTGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADAQDLDLEAGSTASVNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPTPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAG
Molecular weight 51.9kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly238
Protein Accession XP_025850472
Spec:NCBI Gene Aliases NGF
NCBI Reference XP_025850472
Reference PX-P4646
Note For research use only
Molecular Constructor
Met1–Gly238 Fc

Beta-nerve growth factor(NGF) binds to Tanezumab Biosimilar - Anti-IGHE mAb in indirect ELISA assay

Beta-nerve growth factor(NGF) binds to Tanezumab Biosimilar - Anti-IGHE mAb in indirect ELISA assay

Immobilized beta-nerve growth factor(NGF) (cat. No.PX-P4646) at 0.5µg/mL (100µL/well) can bind Tanezumab Biosimilar - Anti-IGHE mAb (cat. No.PX-TA1164) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 229.8M.

SDS-PAGE for beta-nerve growth factor(NGF)

SDS-PAGE for beta-nerve growth factor(NGF)

beta-nerve growth factor(NGF), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

beta-nerve growth factor(NGF)

There are no reviews yet.

Be the first to review “beta-nerve growth factor(NGF)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products