Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fulranumab Biosimilar – Anti-NGF, NGFB mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Fulranumab Biosimilar - Anti-NGF, NGFB mAb - Research Grade

Product name Fulranumab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID P01138
Source CAS 902141-80-4
Species Homo sapiens
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Fulranumab,4D4,AMG-403,JNJ-42160443,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1256
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Fulranumab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID P01138
Source CAS 902141-80-4
Species Homo sapiens
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Fulranumab,4D4,AMG-403,JNJ-42160443,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1256
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1256-50
Uniprot ID P01138
Source CAS 902141-80-4
Species Homo sapiens
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Fulranumab,4D4,AMG-403,JNJ-42160443,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1256
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

General information on Anti-NGF/NGFB[Homo sapiens] (Fulranumab) Monoclonal Antibody

Fulranumab has been investigated for the treatment of Pain, Cystitis, Neuralgia, Joint Pain, and Arthralgia.

SDS-PAGE for Fulranumab Biosimilar - Anti-NGF; NGFB mAb - Research Grade

SDS-PAGE for Fulranumab Biosimilar - Anti-NGF; NGFB mAb - Research Grade

Fulranumab Biosimilar - Anti-NGF; NGFB mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Fulranumab Biosimilar - Anti-NGF, NGFB mAb - Research Grade

There are no reviews yet.

Be the first to review “Fulranumab Biosimilar – Anti-NGF, NGFB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products