Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Frunevetmab Biosimilar – Anti-NGF, NGFB mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $201.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Frunevetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade

Product name Frunevetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID Q6ZY27
Source CAS 1708936-80-4
Species Felinized
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Frunevetmab,NV-02,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1461
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Frunevetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade
Uniprot ID Q6ZY27
Source CAS 1708936-80-4
Species Felinized
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Frunevetmab,NV-02,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1461
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1461-50
Uniprot ID Q6ZY27
Source CAS 1708936-80-4
Species Felinized
Raw Antigen Sequence RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Frunevetmab,NV-02,NGF, NGFB,anti-NGF, NGFB
Reference PX-TA1461
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Frunevetmab Biosimilar, also known as Anti-NGF, NGFB mAb – Research Grade, is a monoclonal antibody that targets the nerve growth factor (NGF) protein. This biosimilar is designed to mimic the structure and function of the original NGF antibody, making it a potential therapeutic option for various conditions related to NGF dysregulation.

Structure of Frunevetmab Biosimilar

Frunevetmab Biosimilar is a recombinant monoclonal antibody that is produced using advanced biotechnology techniques. It is a fully humanized antibody, meaning it is derived from human cells and has a structure that closely resembles natural human antibodies. This makes it less likely to cause adverse reactions in the body.

The antibody has a Y-shaped structure, with two identical “arms” that are responsible for binding to the NGF protein. These arms are made up of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains contain the constant regions, while the light chains contain the variable regions that determine the specificity of the antibody.

Mechanism of Action

Frunevetmab Biosimilar works by binding to NGF and preventing it from interacting with its receptors on nerve cells. NGF is a key factor in the development and maintenance of nerve cells, and its dysregulation has been implicated in various conditions such as chronic pain, osteoarthritis, and cancer-related pain.

By blocking the interaction between NGF and its receptors, Frunevetmab Biosimilar can reduce the signaling pathways that lead to pain and inflammation. This can provide relief for patients suffering from these conditions and potentially slow down disease progression.

Applications of Frunevetmab Biosimilar

Frunevetmab Biosimilar is currently being studied as a potential treatment for various conditions related to NGF dysregulation. This includes chronic pain conditions such as osteoarthritis, diabetic neuropathy, and cancer-related pain. It may also have potential applications in other neurodegenerative diseases, as NGF has been linked to the survival and function of nerve cells.

In addition to its therapeutic potential, Frunevetmab Biosimilar is also being used in research settings to study the role of NGF in various diseases. Its high specificity and affinity for NGF make it a valuable tool for understanding the mechanisms of NGF dysregulation and developing new treatments.

Conclusion

In summary, Frunevetmab Biosimilar is a recombinant monoclonal antibody that targets NGF and has potential applications in the treatment of various conditions related to NGF dysregulation. Its fully humanized structure and mechanism of action make it a promising therapeutic option, and its use in research settings can further our understanding of NGF and its role in disease.

SDS-PAGE for Frunevetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade

SDS-PAGE for Frunevetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade

Frunevetmab Biosimilar - Anti-NGF;Beta-NGF mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Frunevetmab Biosimilar - Anti-NGF, NGFB mAb - Research Grade

There are no reviews yet.

Be the first to review “Frunevetmab Biosimilar – Anti-NGF, NGFB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products