Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gevokizumab Biosimilar – Anti-IL1B mAb – Research Grade

  • PX-TA1068-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $203.00.Current price is: $167.00.

50ug 18% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade

Product name Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade
Uniprot ID P01584
Source CAS 1129435-60-4
Species Humanized
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gevokizumab,XOMA 052,IL1B,anti-IL1B
Reference PX-TA1068
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade
Uniprot ID P01584
Source CAS 1129435-60-4
Species Humanized
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gevokizumab,XOMA 052,IL1B,anti-IL1B
Reference PX-TA1068
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1068-50
Uniprot ID P01584
Source CAS 1129435-60-4
Species Humanized
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gevokizumab,XOMA 052,IL1B,anti-IL1B
Reference PX-TA1068
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Introduction

Gevokizumab Biosimilar, also known as Anti-IL1B mAb, is a therapeutic antibody that targets the inflammatory cytokine interleukin-1 beta (IL-1B). This biosimilar is a research grade version of the original gevokizumab, which was developed by XOMA Corporation and is currently in clinical trials for various inflammatory diseases. In this article, we will explore the structure, activity, and potential applications of Gevokizumab Biosimilar in more detail.

Structure of Gevokizumab Biosimilar

Gevokizumab Biosimilar is a monoclonal antibody (mAb) that is produced from a single type of immune cell. It is a humanized antibody, meaning that it is derived from non-human sources but has been genetically modified to be more similar to human antibodies. The structure of gevokizumab biosimilar consists of two heavy chains and two light chains, which are linked together by disulfide bonds. The variable regions of the antibody, which are responsible for binding to IL-1B, are located at the tips of the heavy and light chains.

Activity of Gevokizumab Biosimilar

The main function of Gevokizumab Biosimilar is to bind to and neutralize IL-1B. IL-1B is a pro-inflammatory cytokine that plays a key role in the body’s immune response. It is produced by various cells, including macrophages and monocytes, and can cause inflammation and tissue damage when present in high levels. By binding to IL-1B, gevokizumab biosimilar prevents it from interacting with its receptors on target cells, thereby reducing its pro-inflammatory effects.

Applications of Gevokizumab Biosimilar

Gevokizumab Biosimilar has potential applications in various inflammatory diseases, as IL-1B is involved in the pathogenesis of many of these conditions. One of the main therapeutic targets for gevokizumab biosimilar is rheumatoid arthritis (RA), a chronic autoimmune disease characterized by joint inflammation and damage. In a phase II clinical trial, gevokizumab was shown to significantly reduce disease activity and improve symptoms in patients with RA.

In addition to RA, gevokizumab biosimilar may also be beneficial in other inflammatory conditions such as gout, osteoarthritis, and psoriasis. It has also shown promise in the treatment of non-infectious uveitis, a form of eye inflammation. In a phase III clinical trial, gevokizumab was found to be effective in reducing the recurrence of uveitis in patients with Behçet’s disease.

Future Directions

As gevokizumab biosimilar is still in the early stages of development, there is much potential for further research and clinical trials to explore its use in other inflammatory diseases. One area of interest is in the treatment of cytokine storm syndrome, a severe immune response that can occur in patients with COVID-19 and other viral infections. IL-1B is thought to play a role in this syndrome, and gevokizumab biosimilar may be a potential treatment option.

Conclusion

In summary, Gevokizumab Biosimilar is a research grade anti-IL1B mAb with a similar structure and activity to the original gevokizumab. It has the potential to be an effective treatment for various inflammatory diseases by targeting IL-1B, a key pro-inflammatory cytokine. With ongoing research and clinical trials, gevokizumab biosimilar may become a valuable therapeutic option for patients with these conditions.

IL1B / IL1F2, C-His, recombinant protein binds to Gevokizumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

IL1B / IL1F2, C-His, recombinant protein binds to Gevokizumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

Immobilized IL1B / IL1F2, C-His, recombinant protein (cat. No.PX-P5783) at 0.5µg/mL (100µL/well) can bind Gevokizumab Biosimilar - Anti-IL1B mAb (cat. No.PX-TA1068) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 4.405M.

SDS-PAGE for Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade

SDS-PAGE for Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade

Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Gevokizumab Biosimilar - Anti-IL1B mAb - Research Grade

There are no reviews yet.

Be the first to review “Gevokizumab Biosimilar – Anti-IL1B mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products