Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Interleukin-1 beta recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01584
Molecular weight:
18.3kDa

$250.00

50ug + 250 loyalty points
Full-length Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Interleukin-1 beta recombinant protein

Product name Human Interleukin-1 beta recombinant protein
Uniprot ID P01584
Uniprot link http://www.uniprot.org/uniprot/P01584
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSHHHHHH
Molecular weight 18.3kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms IL1-B, IL1-Beta, IL1F2, IL-1β, Interleukin-1 Family Member 2, Catabolin
Reference PX-P4022
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Interleukin-1 beta recombinant protein
Uniprot ID P01584
Uniprot link http://www.uniprot.org/uniprot/P01584
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSHHHHHH
Molecular weight 18.3kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms IL1-B, IL1-Beta, IL1F2, IL-1β, Interleukin-1 Family Member 2, Catabolin
Reference PX-P4022
Note For research use only
Molecular Constructor
Full-length Yes

Human IL6 Recombinant Protein binds to Siltuximab Biosimilar – Anti-IL6 mAb in indirect ELISA assay

Human IL6 Recombinant Protein binds to Siltuximab Biosimilar – Anti-IL6 mAb in indirect ELISA assay

There are no reviews yet.

Be the first to review “Human Interleukin-1 beta recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products