Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Canakinumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Canakinumab ELISA Kit

Canakinumab ELISA Kit

Product name Canakinumab ELISA Kit
Uniprot ID P01584
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX131
Note For research use only.
Sample type Plasma, Serum
Target Canakinumab
Immunogen Canakinumab

Introduction

Canakinumab is a human monoclonal antibody that has been developed as a therapeutic agent for the treatment of various inflammatory diseases. It specifically targets interleukin-1 beta (IL-1β), a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of many diseases. The Canakinumab ELISA Kit is a specialized tool that is used for the detection and quantification of Canakinumab in biological samples. In this article, we will discuss the structure, activity, and application of Canakinumab ELISA Kit in detail.

Structure of Canakinumab

Canakinumab is a fully human IgG1 monoclonal antibody that is composed of two heavy chains and two light chains. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), whereas the light chains consist of one constant domain (CL) and one variable domain (VL). Canakinumab is produced through recombinant DNA technology in Chinese hamster ovary (CHO) cells.

Activity of Canakinumab

Canakinumab binds to IL-1β with high affinity and specificity, thereby inhibiting its activity. IL-1β is a potent pro-inflammatory cytokine that is produced by various immune cells in response to infection or injury. It plays a crucial role in the initiation and propagation of inflammation by inducing the production of other pro-inflammatory cytokines, chemokines, and adhesion molecules. Canakinumab blocks the binding of IL-1β to its receptor, thereby preventing the downstream signaling events that lead to inflammation.

Application of Canakinumab ELISA Kit

The Canakinumab ELISA Kit is a valuable tool for the quantification of Canakinumab in biological samples. It is used in various stages of drug development, including preclinical and clinical studies. The following are the key applications of Canakinumab ELISA Kit:

1. Pharmacokinetic Studies Pharmacokinetic studies are essential for evaluating the absorption, distribution, metabolism, and excretion of a drug in the body. Canakinumab ELISA Kit is used to measure the concentration of Canakinumab in plasma or serum samples collected from patients who have received the drug. This information is crucial for determining the optimal dose and dosing regimen of Canakinumab.

2. Immunogenicity Testing Immunogenicity refers to the ability of a drug to induce an immune response in the body. Canakinumab ELISA Kit is used to detect the presence of anti-Canakinumab antibodies in patient samples. These antibodies can neutralize the activity of Canakinumab, leading to reduced efficacy and potential adverse effects. Therefore, immunogenicity testing is essential for monitoring the safety and efficacy of Canakinumab treatment.

3. Biomarker Analysis IL-1β is a biomarker for various inflammatory diseases, including rheumatoid arthritis, gout, and cardiovascular diseases. Canakinumab ELISA Kit can be used to measure the levels of IL-1β in patient samples before and after treatment with Canakinumab. This information can help in assessing the effectiveness of Canakinumab in reducing inflammation and disease severity.

4. Quality Control Canakinumab ELISA Kit is also used for quality control purposes in the production of Canakinumab. It ensures that the drug product meets the required specifications and is free from impurities that may affect its safety and efficacy.

Conclusion

In summary, Canakinumab ELISA Kit is a specialized tool that is used for the detection and quantification of Canakinumab in biological samples. It plays a crucial role in the development and monitoring of Canakinumab as a therapeutic agent for inflammatory diseases. The structure and activity of Canakinumab and the various applications of Canakinumab ELISA

Canakinumab ELISA Kit

There are no reviews yet.

Be the first to review “Canakinumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products