Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gremubamab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Gremubamab ELISA Kit

Gremubamab ELISA Kit

Product name Gremubamab ELISA Kit
Uniprot ID O30527
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX291
Note For research use only.
Sample type Plasma, Serum
Target Gremubamab
Immunogen Gremubamab

The Structure of Gremubamab ELISA Kit

Gremubamab ELISA Kit is a highly specific and sensitive assay used for the detection and quantification of Gremubamab, a novel therapeutic antibody. The kit is designed to measure the levels of Gremubamab in various biological samples, including serum, plasma, and cell culture supernatants. The kit utilizes a sandwich enzyme-linked immunosorbent assay (ELISA) format, where the target Gremubamab is captured by a specific antibody coated on the surface of a microplate. The captured Gremubamab is then detected by a second antibody, which is conjugated to an enzyme that produces a colorimetric signal upon substrate addition.

The Gremubamab ELISA Kit contains all the necessary reagents and components for the accurate and reproducible measurement of Gremubamab levels. These include a pre-coated microplate, Gremubamab standards, detection antibody, enzyme conjugate, and substrate solution. The kit also includes a detailed protocol for sample preparation and assay procedure, making it easy to use for both experienced and novice researchers.

The Activity of Gremubamab

Gremubamab is a monoclonal antibody that specifically targets and inhibits the activity of the protein Grem1. Grem1 is a secreted protein that belongs to the Dan family of BMP (bone morphogenetic protein) antagonists. It is known to play a crucial role in various biological processes, including embryonic development, tissue homeostasis, and tumorigenesis. Grem1 has been shown to promote the growth and survival of cancer cells, making it an attractive therapeutic target for cancer treatment.

Gremubamab binds to Grem1 with high affinity and blocks its interaction with BMP ligands, thereby inhibiting its pro-tumorigenic activity. This leads to the suppression of tumor growth and progression, making Gremubamab a promising therapeutic agent for cancer therapy. In addition, Gremubamab has also been shown to have anti-angiogenic effects, further contributing to its anti- cancer activity.

The Application of Gremubamab ELISA Kit

The Gremubamab ELISA Kit has various applications in both research and clinical settings. In research, it can be used to measure the levels of Gremubamab in biological samples from preclinical studies, to assess its pharmacokinetics and pharmacodynamics. It can also be used to study the expression and regulation of Grem1 in different cell types and tissues.

In clinical settings, the Gremubamab ELISA Kit can be used for the diagnosis and monitoring of cancer patients who are receiving Gremubamab treatment. The kit can also be used for the quantification of Gremubamab in patient samples to evaluate its efficacy and determine the optimal dosage for individual patients. Furthermore, the Gremubamab ELISA Kit can also be used for the development of companion diagnostics, which can help identify patients who are most likely to benefit from Gremubamab treatment.

In conclusion, the Gremubamab ELISA Kit is a valuable tool for the detection and quantification of Gremubamab in various biological samples. Its high sensitivity and specificity make it an ideal choice for studying the structure, activity, and application of this novel therapeutic antibody. With the increasing interest in Gremubamab as a potential cancer therapy, the Gremubamab ELISA Kit is expected to play a crucial role in advancing our understanding and utilization of this promising therapeutic agent.

Gremubamab ELISA Kit

There are no reviews yet.

Be the first to review “Gremubamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products