Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gremubamab Biosimilar – Anti-PcrV and Psl mAb – Research Grade

Isotype:
VH-CH1-VH-V-KAPPA-CH2-CH3

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Gremubamab Biosimilar - Anti-PcrV and Psl mAb - Research Grade

Product name Gremubamab Biosimilar - Anti-PcrV mAb - Research Grade
Uniprot ID O30527
Source CAS 1800381-36-5
Species Homo sapiens,Humanized
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gremubamab ,MEDI3902,PcrV,anti-PcrV
Reference PX-TA1591
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-CH1-VH-V-KAPPA-CH2-CH3
Clonality Monoclonal Antibody
Product name Gremubamab Biosimilar - Anti-PcrV mAb - Research Grade
Uniprot ID O30527
Source CAS 1800381-36-5
Species Homo sapiens,Humanized
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gremubamab ,MEDI3902,PcrV,anti-PcrV
Reference PX-TA1591
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-CH1-VH-V-KAPPA-CH2-CH3
Clonality Monoclonal Antibody
Product name PX-TA1591-50
Uniprot ID O30527
Source CAS 1800381-36-5
Species Homo sapiens,Humanized
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gremubamab ,MEDI3902,PcrV, Psl,anti-PcrV and Psl
Reference PX-TA1591
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-CH1-VH-V-KAPPA-CH2-CH3

Introduction to Gremubamab Biosimilar as a Therapeutic Antibody

Gremubamab Biosimilar is a research-grade therapeutic antibody developed to target critical virulence determinants of Pseudomonas aeruginosa, a Gram-negative pathogen responsible for severe acute and chronic infections. This monoclonal antibody is designed to recognize PcrV, a key structural protein of the Type III Secretion System (T3SS), and Psl, a major exopolysaccharide involved in biofilm formation. By addressing both virulence and persistence mechanisms, Gremubamab Biosimilar supports advanced research into antibody-based anti-infective strategies.

Molecular Structure and Design

Gremubamab Biosimilar is a recombinant monoclonal IgG antibody produced under controlled expression conditions to ensure structural consistency and reproducibility. It consists of two heavy chains and two light chains forming the characteristic Y-shaped IgG structure. The Fab regions are optimized for high-affinity binding to conserved epitopes of PcrV and Psl, while the Fc region retains the native IgG architecture, allowing interaction with immune effector pathways in experimental systems. As a biosimilar, it closely mirrors the structural and functional attributes of the reference molecule, making it suitable for comparative and mechanistic studies.

Target Recognition and Biological Activity

The biological activity of this therapeutic antibody relies on its dual-targeting capability. Binding to PcrV interferes with the formation and stability of the T3SS needle tip complex, a structure essential for the translocation of bacterial effector proteins into host cells. This interaction effectively reduces cytotoxicity and limits acute infection-associated damage. Simultaneously, binding to the Psl exopolysaccharide disrupts bacterial adhesion and aggregation, weakening biofilm integrity and surface persistence. These complementary activities make Gremubamab Biosimilar a powerful tool to investigate virulence attenuation without directly affecting bacterial viability.

Research Applications and Experimental Use

Gremubamab Biosimilar is intended exclusively for research use and is widely applied in microbiology and immunology studies. Common applications include in vitro T3SS inhibition assays, biofilm formation and disruption studies, flow cytometry and immunofluorescence detection of Psl, and functional characterization of antibody-mediated neutralization. The antibody is also used in preclinical infection models to evaluate host–pathogen interactions and to explore combination approaches with conventional antibiotics. Its biosimilar nature makes it particularly valuable for benchmarking and validation of novel anti-Pseudomonas antibody candidates.

Importance for Therapeutic Antibody Development

From a translational perspective, Gremubamab Biosimilar provides insight into alternative anti-infective approaches based on therapeutic antibodies. By targeting virulence factors rather than bacterial survival, this strategy may reduce selective pressure associated with antibiotic resistance. The simultaneous targeting of PcrV and Psl also illustrates the potential benefits of multi-target antibody designs for addressing both acute infection and biofilm-associated chronic disease.

Conclusion

In conclusion, Gremubamab Biosimilar is a well-characterized, research-grade anti-PcrV and Psl monoclonal therapeutic antibody offering broad utility for studying Pseudomonas aeruginosa pathogenesis. Its defined structure, dual biological activity, and versatility in experimental applications make it an essential reagent for advancing antibody-based anti-infective research and supporting the development of next-generation therapeutic strategies.

Gremubamab Biosimilar - Anti-PcrV and Psl mAb - Research Grade in ELISA Assay

Gremubamab Biosimilar - Anti-PcrV and Psl mAb - Research Grade in ELISA Assay

Gremubamab Biosimilar - Anti-PcrV and Psl mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Gremubamab  Biosimilar - Anti-PcrV and Psl mAb - Research Grade

  • Desveaux JM, Faudry E, Contreras-Martel C, et al. Neutralizing human monoclonal antibodies that target the PcrV component of the type III secretion system of <i>Pseudomonas aeruginosa</i> act through distinct mechanisms. Elife. 2026 Feb;14:RP105195. DOI: 10.7554/elife.105195. PMID: 41700594; PMCID: PMC12912723 https://doi.org/10.7554/elife.105195

There are no reviews yet.

Be the first to review “Gremubamab Biosimilar – Anti-PcrV and Psl mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products