Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Canakinumab Biosimilar – Anti-IL1B mAb – Research Grade

  • PX-TA1176-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

Product name Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade
Uniprot ID P01584
Source CAS 914613-48-2
Species Homo sapiens
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Canakinumab,ACZ885,IL1B,anti-IL1B
Reference PX-TA1176
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade
Uniprot ID P01584
Source CAS 914613-48-2
Species Homo sapiens
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Canakinumab,ACZ885,IL1B,anti-IL1B
Reference PX-TA1176
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1176-50
Uniprot ID P01584
Source CAS 914613-48-2
Species Homo sapiens
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Canakinumab,ACZ885,IL1B,anti-IL1B
Reference PX-TA1176
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Canakinumab Biosimilar, also known as Anti-IL1B mAb, is a research grade antibody that targets the cytokine interleukin-1 beta (IL-1B). This therapeutic antibody has shown promising results in treating various inflammatory diseases and is currently being studied for its potential in other therapeutic areas. In this article, we will discuss the structure, activity, and application of Canakinumab Biosimilar in detail.

Structure of Canakinumab Biosimilar

Canakinumab Biosimilar is a monoclonal antibody (mAb) that specifically binds to and neutralizes IL-1B. It is a recombinant human IgG1 kappa antibody with a molecular weight of approximately 148 kDa. The antibody is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions are responsible for binding to the target IL-1B, while the constant regions provide stability and effector functions.

Activity of Canakinumab Biosimilar

The main activity of Canakinumab Biosimilar is its ability to block the activity of IL-1B. IL-1B is a pro-inflammatory cytokine that plays a crucial role in the initiation and propagation of inflammatory responses. It is produced by various cell types, including immune cells, and can lead to tissue damage and disease progression if left unchecked. Canakinumab Biosimilar binds to IL-1B and prevents it from binding to its receptor, thereby inhibiting its pro-inflammatory effects.

In addition to its neutralizing activity, Canakinumab Biosimilar also has effector functions that can further enhance its therapeutic effects. These include antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which can help eliminate target cells and reduce inflammation.

Application of Canakinumab Biosimilar

Canakinumab Biosimilar has been approved for the treatment of several inflammatory diseases, including cryopyrin-associated periodic syndromes (CAPS), systemic juvenile idiopathic arthritis (SJIA), and familial Mediterranean fever (FMF). It has also shown promising results in clinical trials for other indications such as gout, rheumatoid arthritis, and atherosclerosis.

In CAPS, Canakinumab Biosimilar has been shown to effectively reduce disease symptoms and improve quality of life in patients. In SJIA, it has demonstrated significant reduction in disease activity and improved physical function. In FMF, Canakinumab Biosimilar has been shown to decrease the frequency and severity of attacks.

Moreover, Canakinumab Biosimilar is also being investigated for its potential in other therapeutic areas, such as cardiovascular diseases, neuroinflammation, and cancer. IL-1B has been implicated in the pathogenesis of these diseases, and Canakinumab Biosimilar’s ability to block its activity makes it a promising candidate for further research.

Conclusion

In summary, Canakinumab Biosimilar is a research grade antibody that specifically targets IL-1B and has shown promising results in treating various inflammatory diseases. Its structure, activity, and application make it a valuable tool for researchers and clinicians in the field of immunology and inflammation. Further studies on its potential in other therapeutic areas may lead to the development of new treatment options for patients.

IL1B / IL1F2, C-His, recombinant protein binds to Canakinumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

IL1B / IL1F2, C-His, recombinant protein binds to Canakinumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

Immobilized IL1B / IL1F2, C-His, recombinant protein (cat. No.PX-P5783) at 0.5µg/mL (100µL/well) can bind Canakinumab Biosimilar - Anti-IL1B mAb (cat. No.PX-TA1176) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1182M.

SDS-PAGE for Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

SDS-PAGE for Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

Flow Cytometry results for Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

Flow-cytometry using PE anti-human IL1B antibody. 5637 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an PE anti-human IL1B monoclonal antibody (Catalog PX-TA1176, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

There are no reviews yet.

Be the first to review “Canakinumab Biosimilar – Anti-IL1B mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products