Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lumiliximab Biosimilar – Anti-FCER2 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lumiliximab Biosimilar - Anti-FCER2 mAb - Research Grade

Product name Lumiliximab Biosimilar - Anti-FCER2 mAb - Research Grade
Uniprot ID P06734
Source CAS 357613-86-6
Species Chimeric
Raw Antigen Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lumiliximab,IDEC-152,P5E8,FCER2,anti-FCER2
Reference PX-TA1114
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Lumiliximab Biosimilar - Anti-FCER2 mAb - Research Grade
Uniprot ID P06734
Source CAS 357613-86-6
Species Chimeric
Raw Antigen Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lumiliximab,IDEC-152,P5E8,FCER2,anti-FCER2
Reference PX-TA1114
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1114-50
Uniprot ID P06734
Source CAS 357613-86-6
Species Chimeric
Raw Antigen Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lumiliximab,IDEC-152,P5E8,FCER2,anti-FCER2
Reference PX-TA1114
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Lumiliximab Biosimilar: A Promising Anti-FCER2 mAb for Targeted Therapy

Lumiliximab Biosimilar, also known as Anti-FCER2 mAb, is a monoclonal antibody that has shown great potential in the treatment of various diseases. This biosimilar is a replica of the original Lumiliximab, which is a humanized anti-CD23 monoclonal antibody. It has been developed to target the Fc epsilon receptor 2 (FCER2) protein, also known as CD23, which is a cell surface receptor expressed on various immune cells. FCER2 plays a crucial role in regulating the immune response and is involved in the pathogenesis of many diseases. Lumiliximab Biosimilar is a research-grade antibody that has been extensively studied for its structure, activity, and potential applications in the field of targeted therapy.

Structure of Lumiliximab Biosimilar

Lumiliximab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is composed of two heavy chains and two light chains. The heavy chains consist of a variable region (VH) and a constant region (CH). The light chains also have a variable region (VL) and a constant region (CL). The variable regions of both the heavy and light chains are responsible for binding to the target protein, FCER2. The constant regions are responsible for effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

The structure of Lumiliximab Biosimilar has been modified to enhance its binding affinity and specificity for FCER2. This modification involves the replacement of certain amino acids in the variable regions with humanized counterparts. This ensures that the antibody is less immunogenic and can be safely administered to patients without causing adverse reactions.

Activity of Lumiliximab Biosimilar

Lumiliximab Biosimilar has been shown to specifically bind to FCER2 with high affinity. This binding results in the inhibition of FCER2 signaling, which is involved in the activation and proliferation of immune cells. By blocking FCER2, Lumiliximab Biosimilar can modulate the immune response and regulate the production of inflammatory mediators, such as cytokines and chemokines.

In addition to its inhibitory activity, Lumiliximab Biosimilar also has effector functions that can contribute to its therapeutic efficacy. Through ADCC and CDC, the antibody can target and eliminate FCER2-expressing cells, such as B cells and eosinophils, which are involved in the pathogenesis of various diseases.

Applications of Lumiliximab Biosimilar

Lumiliximab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various diseases. One of its potential applications is in the treatment of allergic diseases, such as asthma and allergic rhinitis, where FCER2 plays a critical role in the inflammatory response. By blocking FCER2, Lumiliximab Biosimilar can reduce the symptoms and severity of these diseases.

Another potential application of Lumiliximab Biosimilar is in the treatment of B-cell malignancies, such as chronic lymphocytic leukemia (CLL) and non-Hodgkin’s lymphoma (NHL). FCER2 is overexpressed on the surface of malignant B cells, making it a suitable therapeutic target. Lumiliximab Biosimilar has been shown to induce apoptosis in these cells and inhibit their proliferation, making it a promising therapy for these types of cancers.

Furthermore, Lumiliximab Biosimilar has also been studied for its potential use in the treatment of autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. By modulating the immune response, the antibody can potentially reduce the symptoms and progression of these diseases.

SDS-PAGE for Lumiliximab Biosimilar - Anti-CD23;FCER2 mAb - Research Grade

SDS-PAGE for Lumiliximab Biosimilar - Anti-CD23;FCER2 mAb - Research Grade

Lumiliximab Biosimilar - Anti-CD23;FCER2 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Lumiliximab Biosimilar - Anti-FCER2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Lumiliximab Biosimilar – Anti-FCER2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products