Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

BHQ880 Biosimilar – Anti-DKK1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa(silence)

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

BHQ880 Biosimilar - Anti-DKK1 mAb - Research Grade

Product name BHQ880 Biosimilar - Anti-DKK1 mAb - Research Grade
Uniprot ID O94907
Species Human
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Dickkopf-1, SK, hDkk-1, Dkk-1, Dickkopf-related protein 1, DKK1
Reference PX-TA1933
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa(silence)
Clonality Monoclonal Antibody
Product name BHQ880 Biosimilar - Anti-DKK1 mAb - Research Grade
Uniprot ID O94907
Species Human
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Dickkopf-1, SK, hDkk-1, Dkk-1, Dickkopf-related protein 1, DKK1
Reference PX-TA1933
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa(silence)
Clonality Monoclonal Antibody
Product name PX-TA1933-50
Uniprot ID O94907
Species Human
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Dickkopf-1, SK, hDkk-1, Dkk-1, Dickkopf-related protein 1, DKK1
Reference PX-TA1933
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa(silence)
Clonality Monoclonal Antibody

The Structure of BHQ880 Biosimilar – Anti-DKK1 mAb

BHQ880 Biosimilar, also known as Anti-DKK1 mAb, is a monoclonal antibody (mAb) that is designed to target and inhibit the activity of the protein Dickkopf-1 (DKK1). It is a biosimilar version of the original BHQ880 antibody, which was developed by Boehringer Ingelheim as a potential therapeutic for various diseases including cancer and osteoporosis.

The BHQ880 Biosimilar is a fully humanized antibody, meaning that it is derived from human cells and has a structure similar to naturally occurring antibodies in the body. It is composed of two heavy chains and two light chains, each with a specific amino acid sequence that determines its function and specificity.

The heavy chains of BHQ880 Biosimilar contain a constant region, which is responsible for binding to immune cells and activating the immune response, and a variable region, which is unique to each antibody and determines its target specificity. The light chains also have a constant and variable region, and together with the heavy chains, they form the antigen-binding site of the antibody.

The antigen-binding site of BHQ880 Biosimilar is specifically designed to recognize and bind to DKK1, a protein that plays a crucial role in regulating the Wnt signaling pathway. DKK1 is known to inhibit the activity of this pathway, which is involved in cell growth, differentiation, and survival. By targeting DKK1, BHQ880 Biosimilar is able to block its inhibitory effects and restore the normal function of the Wnt pathway.

The Activity of BHQ880 Biosimilar – Anti-DKK1 mAb

BHQ880 Biosimilar is a potent inhibitor of DKK1 and has been shown to effectively neutralize its activity in various in vitro and in vivo studies. It binds to DKK1 with high affinity and prevents it from interacting with its receptor, thus blocking its inhibitory effects on the Wnt pathway.

The Wnt pathway is involved in a wide range of cellular processes, including cell proliferation, differentiation, and survival. Dysregulation of this pathway has been linked to various diseases, including cancer and osteoporosis. By inhibiting DKK1, BHQ880 Biosimilar has the potential to treat these diseases by restoring the normal function of the Wnt pathway.

In addition to its inhibitory effects on DKK1, BHQ880 Biosimilar also has the ability to induce antibody-dependent cell-mediated cytotoxicity (ADCC). This means that it can recruit immune cells to target and destroy cells that express high levels of DKK1, such as cancer cells. This dual mechanism of action makes BHQ880 Biosimilar a promising therapeutic candidate for various diseases.

The Application of BHQ880 Biosimilar – Anti-DKK1 mAb

BHQ880 Biosimilar is currently being evaluated in clinical trials for the treatment of multiple myeloma, a type of blood cancer, and osteoporosis, a bone disease. These diseases are known to involve dysregulation of the Wnt pathway, making DKK1 a potential therapeutic target.

In preclinical studies, BHQ880 Biosimilar has shown promising results in inhibiting tumor growth and improving bone density. It has also demonstrated a favorable safety profile, with no significant adverse effects observed.

In addition to its potential as a therapeutic, BHQ880 Biosimilar can also be used as a research tool to study the role of DKK1 in various diseases and to further understand the mechanisms of the Wnt signaling pathway.

In conclusion, BHQ880 Biosimilar – Anti-DKK1 mAb is a fully humanized monoclonal antibody that targets and inhibits the activity of DKK1. Its unique structure and dual mechanism of action make it a promising therapeutic candidate for multiple myeloma, osteoporosis, and potentially other diseases involving dysregulation of the Wnt pathway. Its application extends beyond therapy, as it can also be used as a research tool to further our understanding of DKK1 and the Wnt pathway.

SDS-PAGE for Research Grade BHQ880

SDS-PAGE for Research Grade BHQ880

Research Grade BHQ880, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

BHQ880 Biosimilar - Anti-DKK1 mAb - Research Grade

There are no reviews yet.

Be the first to review “BHQ880 Biosimilar – Anti-DKK1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products