Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pintumomab Biosimilar – Anti-DPEP3 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $386.00.Current price is: $308.00.

50ug 20% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade

Product name Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade
Uniprot ID Q9H4B8
Source 170, CAS: 339177-26-3
Species Mus musculus
Expression system XtenCHO
Raw Antigen Sequence MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-DPEP3,Dipeptidase 3,
Reference PX-TA1922
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade
Uniprot ID Q9H4B8
Source 170, CAS: 339177-26-3
Species Mus musculus
Expression system XtenCHO
Raw Antigen Sequence MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-DPEP3,Dipeptidase 3,
Reference PX-TA1922
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1922-50
Uniprot ID Q9H4B8
Source 170, CAS: 339177-26-3
Species Mus musculus
Expression system XtenCHO
Raw Antigen Sequence MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-DPEP3,Dipeptidase 3,
Reference PX-TA1922
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Pintumomab Biosimilar – Anti-DPEP3 mAb – Research Grade

Pintumomab Biosimilar is a monoclonal antibody (mAb) that specifically targets DPEP3, a cell surface protein that is overexpressed in various types of cancer. This biosimilar is a highly potent and specific therapeutic agent that has been developed to mimic the activity of the original pintumomab antibody, which has shown promising results in clinical trials for the treatment of cancer.

Structure of Pintumomab Biosimilar

Pintumomab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, meaning it is made up of human and non-human components. The antibody consists of two heavy chains and two light chains, each with a variable region that specifically binds to DPEP3. These variable regions are derived from the original pintumomab antibody, while the constant regions are humanized to reduce the risk of immune reactions.

The structure of Pintumomab Biosimilar allows it to bind to DPEP3 with high affinity and specificity, making it a highly effective therapeutic agent for targeting cancer cells.

Activity of Pintumomab Biosimilar

Pintumomab Biosimilar works by binding to DPEP3 on the surface of cancer cells, which triggers a series of events that lead to the destruction of these cells. The binding of the antibody to DPEP3 activates the immune system, specifically the complement system, to attack and destroy the cancer cells. This process is known as antibody-dependent cellular cytotoxicity (ADCC) and is a key mechanism of action for pintumomab and its biosimilar.

In addition to ADCC, Pintumomab Biosimilar also induces apoptosis, or programmed cell death, in cancer cells. This is achieved by blocking the signaling pathways that promote cell survival and growth, ultimately leading to the death of the cancer cells.

Application of Pintumomab Biosimilar

Pintumomab Biosimilar is currently being investigated as a potential treatment for various types of cancer, including breast, lung, and pancreatic cancer. It has shown promising results in preclinical studies and is now being evaluated in clinical trials.

One of the advantages of using a biosimilar version of pintumomab is that it can potentially provide similar therapeutic benefits at a lower cost, making it more accessible to patients. This is particularly important in the field of cancer treatment, where the cost of therapy can be a major barrier for many patients.

Furthermore, as a research grade antibody, Pintumomab Biosimilar can also be used in laboratory settings for studying the role of DPEP3 in cancer development and progression. Its high specificity and potency make it a valuable tool for researchers studying this therapeutic target.

Conclusion

Pintumomab Biosimilar is a highly specific and potent monoclonal antibody that targets DPEP3, a cell surface protein that is overexpressed in various types of cancer. Its structure, activity, and potential applications make it a promising therapeutic agent for the treatment of cancer. With ongoing research and clinical trials, Pintumomab Biosimilar has the potential to improve the treatment options available for cancer patients and contribute to the fight against this devastating disease.

SDS-PAGE for Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade

SDS-PAGE for Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade

Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Pintumomab Biosimilar – Anti-DPEP3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products