Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human DKK1 Antibody (DKN-01)

  • ARO-A13160-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Host species:
Mouse

Original price was: $414.00.Current price is: $305.00.

50ug 26% OFF + 305 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human DKK1 Antibody (DKN-01)

Product name ARO-A13160-100
Uniprot ID O94907
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Dickkopf-1, SK, hDkk-1, Dkk-1, Dickkopf-related protein 1, DKK1
Reference ARO-A13160
Clonality Monoclonal Antibody
Protein Name Dickkopf-1
Product name ARO-A13160-1MG
Uniprot ID O94907
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Dickkopf-1, SK, hDkk-1, Dkk-1, Dickkopf-related protein 1, DKK1
Reference ARO-A13160
Clonality Monoclonal Antibody
Protein Name Dickkopf-1
Product name ARO-A13160-50
Uniprot ID O94907
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Dickkopf-1, SK, hDkk-1, Dkk-1, Dickkopf-related protein 1, DKK1
Reference ARO-A13160
Clonality Monoclonal Antibody
Protein Name Dickkopf-1

SDS-PAGE for InVivoMAb Anti-Human DKK1 Antibody (DKN-01)

SDS-PAGE for InVivoMAb Anti-Human DKK1 Antibody (DKN-01)

InVivoMAb Anti-Human DKK1 Antibody (DKN-01), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

InVivoMAb Anti-Human DKK1 Antibody (DKN-01) binds to Recombinant Mouse DKK1 Protein, N-His in ELISA Assay

InVivoMAb Anti-Human DKK1 Antibody (DKN-01) binds to Recombinant Mouse DKK1 Protein, N-His in ELISA Assay

Recombinant Mouse DKK1 Protein, N-His(cat. No.ARO-P10628) at 0.5µg/mL (100µL/well) can bind InVivoMAb Anti-Human DKK1 Antibody (DKN-01) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human DKK1 Antibody (DKN-01)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products