Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Foravirumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Foravirumab ELISA Kit

Foravirumab ELISA Kit

Product name Foravirumab ELISA Kit
Uniprot ID O92284
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX287
Note For research use only.
Sample type Plasma, Serum
Target Foravirumab
Immunogen Foravirumab

Introduction to Foravirumab ELISA Kit

Foravirumab is a monoclonal antibody that has shown promising results in the treatment of various diseases. It is a humanized IgG1 kappa antibody that specifically targets a protein known as CD40. CD40 is a cell surface receptor that plays a crucial role in immune responses and has been identified as a potential therapeutic target for a wide range of diseases.

Structure of Foravirumab

Foravirumab is a fully humanized monoclonal antibody that is produced using recombinant DNA technology. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding Fab regions and one Fc region responsible for effector functions.

The variable regions of Foravirumab are derived from human antibody sequences, while the constant regions are from a mouse antibody. This allows foravirumab to have a high binding affinity for its target, CD40, while also reducing the risk of immunogenicity in patients.

Mechanism of Action

Foravirumab works by binding to the CD40 receptor on the surface of cells. This binding blocks the interaction between CD40 and its ligand, preventing downstream signaling pathways that are involved in immune responses. By inhibiting the CD40 pathway, foravirumab can modulate immune responses and potentially treat a variety of diseases.

CD40 is expressed on a wide range of cells, including immune cells such as B cells, T cells, and dendritic cells, as well as non-immune cells like endothelial cells and fibroblasts. This broad expression pattern makes CD40 an attractive target for therapeutic intervention.

Applications of Foravirumab ELISA Kit

The Foravirumab ELISA Kit is a valuable tool for researchers and clinicians studying the role of CD40 in various diseases. This kit utilizes the sandwich ELISA technique to detect and quantify the levels of foravirumab in biological samples.

The Foravirumab ELISA Kit can be used to measure the pharmacokinetics of foravirumab in patients, providing important information on drug absorption, distribution, metabolism, and excretion. This data can help optimize dosing regimens and improve treatment outcomes.

Furthermore, the Foravirumab ELISA Kit can be used to monitor the efficacy of foravirumab treatment in patients with CD40-related diseases. By measuring the levels of foravirumab in patient samples, researchers can assess the drug’s ability to inhibit the CD40 pathway and potentially predict treatment response.

Conclusion

The Foravirumab ELISA Kit is a valuable tool for studying the structure, activity, and application of this promising monoclonal antibody. Its high specificity and sensitivity make it an ideal choice for measuring foravirumab levels in various biological samples. As research on CD40 and its role in diseases continues to grow, the Foravirumab ELISA Kit will play an important role in advancing our understanding of this therapeutic target and its potential for treating a wide range of diseases.

Foravirumab ELISA Kit

There are no reviews yet.

Be the first to review “Foravirumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products