Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Foravirumab Biosimilar – Anti-RV mAb – Research Grade

  • PX-TA1064-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Foravirumab Biosimilar - Anti-RV mAb - Research Grade

Product name Foravirumab Biosimilar - Anti-RV mAb - Research Grade
Uniprot ID O92284
Source CAS 944548-38-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Foravirumab,CR4098,RV,anti-RV
Reference PX-TA1064
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Foravirumab Biosimilar - Anti-RV mAb - Research Grade
Uniprot ID O92284
Source CAS 944548-38-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Foravirumab,CR4098,RV,anti-RV
Reference PX-TA1064
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1064-50
Uniprot ID O92284
Source CAS 944548-38-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Foravirumab,CR4098,RV,anti-RV
Reference PX-TA1064
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Foravirumab Biosimilar, also known as Anti-RV mAb, is a research grade monoclonal antibody that has been developed as a biosimilar to the original Foravirumab. This antibody is designed to specifically target the respiratory syncytial virus (RSV), a common cause of respiratory tract infections in infants and young children. In this article, we will discuss the structure, activity, and potential applications of Foravirumab Biosimilar in more detail.

Structure of Foravirumab Biosimilar

Foravirumab Biosimilar is a monoclonal antibody that is produced in a laboratory setting. It is a protein molecule that is made up of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains are approximately 50 kDa in size, while the light chains are approximately 25 kDa. The exact sequence and structure of Foravirumab Biosimilar is highly similar to the original Foravirumab, making it a biosimilar product.

Activity of Foravirumab Biosimilar

Foravirumab Biosimilar is a potent inhibitor of the respiratory syncytial virus (RSV). It works by binding to a specific protein on the surface of the virus, known as the fusion protein. This prevents the virus from entering and infecting host cells, thereby reducing the severity and duration of RSV infections. Foravirumab Biosimilar has been shown to have high specificity and affinity for the RSV fusion protein, making it a highly effective therapeutic agent.

Applications of Foravirumab Biosimilar

Foravirumab Biosimilar is primarily being developed as a therapeutic agent for the treatment of RSV infections. It is currently in preclinical and clinical trials, with the aim of obtaining regulatory approval for use in humans. If successful, Foravirumab Biosimilar could be used in the treatment of RSV infections in infants and young children, who are at the highest risk of severe complications from the virus.

In addition to its potential use as a therapeutic agent, Foravirumab Biosimilar also has applications in research. As a biosimilar product, it can be used in laboratory studies to understand the mechanism of action of the original Foravirumab and to compare its efficacy and safety to the biosimilar version. This can provide valuable insights into the development and production of biosimilar antibodies in general.

Advantages of Foravirumab Biosimilar

Foravirumab Biosimilar offers several advantages over the original Foravirumab. Firstly, as a biosimilar product, it is expected to have a lower cost compared to the original, making it more accessible to patients. Secondly, the production of biosimilar antibodies is a well-established process, which can lead to a more consistent and reliable supply of Foravirumab Biosimilar. Lastly, the development of biosimilar products promotes competition and can drive down the overall cost of biologic therapies.

Conclusion

In summary, Foravirumab Biosimilar, also known as Anti-RV mAb, is a research grade monoclonal antibody that specifically targets the respiratory syncytial virus. It has a similar structure and activity to the original Foravirumab, but offers potential advantages in terms of cost and production. With ongoing research and clinical trials, Foravirumab Biosimilar has the potential to become an important therapeutic agent for the treatment of RSV infections in infants and young children.

Foravirumab Biosimilar - Anti-G;Glycoprotein mAb - Research Grade binds to Rabies virus/RABV G/Glycoprotein recombinant protein in ELISA assay

Foravirumab Biosimilar - Anti-G;Glycoprotein mAb - Research Grade binds to Rabies virus/RABV G/Glycoprotein recombinant protein in ELISA assay

Immobilized Rabies virus/RABV G/Glycoprotein recombinant protein (cat. No.PX-P6266) at 0.5µg/mL (100µL/well) can bind Foravirumab Biosimilar - Anti-G;Glycoprotein mAb - Research Grade (cat. No.PX-TA1064) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.210M.

Foravirumab Biosimilar - Anti-RV mAb - Research Grade

There are no reviews yet.

Be the first to review “Foravirumab Biosimilar – Anti-RV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products