Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mucin-5B(MUC5B)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9HC84
Molecular weight:
37.43kDa

$392.00

100ug + 392 loyalty points
Ser5657–Ala5756
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mucin-5B(MUC5B)

Mucin-5B(MUC5B)

Product name Mucin-5B(MUC5B)
Uniprot ID Q9HC84
Uniprot link https://www.uniprot.org/uniprot/Q9HC84
Expression system Prokaryotic expression
Sequence MGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDENLYFQGSCQVRINTTILWHQGCETEVNITFAEGSCPGASKYSAEAQAMQHQCTCAQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPA
Molecular weight 37.43kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser5657-Ala5756
Aliases /Synonyms MUC-5B,Cervical mucin,High molecular weight salivary mucin MG1,Mucin-5 subtype B, tracheobronchial,Sublingual gland mucin,MUC5
Reference PX-P4752
Note For research use only
Molecular Constructor
Ser5657–Ala5756
Product name Mucin-5B(MUC5B)
Uniprot ID Q9HC84
Uniprot link https://www.uniprot.org/uniprot/Q9HC84
Expression system Prokaryotic expression
Sequence MGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDENLYFQGSCQVRINTTILWHQGCETEVNITFAEGSCPGASKYSAEAQAMQHQCTCAQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPA
Molecular weight 37.43kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser5657-Ala5756
Aliases /Synonyms MUC-5B,Cervical mucin,High molecular weight salivary mucin MG1,Mucin-5 subtype B, tracheobronchial,Sublingual gland mucin,MUC5
Reference PX-P4752
Note For research use only
Molecular Constructor
Ser5657–Ala5756

There are no reviews yet.

Be the first to review “Mucin-5B(MUC5B)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products