Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Trichinella spiralis NBL-1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Trichinella spiralis
Uniprot ID:
Q9BJL7
Molecular weight:
44,96 kDa

$250.00

+ 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Trichinella spiralis NBL-1 Recombinant Protein

Trichinella spiralis NBL-1 Recombinant Protein

Product name Trichinella spiralis NBL-1 Recombinant Protein
Uniprot ID Q9BJL7
Uniprot link http://www.uniprot.org/uniprot/Q9BJL7
Origin species Trichinella spiralis
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLAFECGVPHFKPYIWKSGRIVGGTDVRPHSHPWQIQLLKSETGGYSSLCGGSLVHFGKPSNGTRFVLTAA HCITTSNMYPRTSRFTVVTGAHNIKMHEKEKKRIPITSYYVQHWNPVMTTNDIALLRLAETVYYNEYTRPVCLPEPNEEL TPGDICVVTGWGDTTENGTTSNTLKQVGVKIMKKGTCANVRSEVITFCAGAMEGGKDSCQGDSGGPLICKKNGKSVQFGV VSYGTGCARKGYPGVYAKVPSYVTWLNKAAKELENSPEGTVKWASKEDSPVDLSTASRPTNPYTGSRPTSPSSGSRPTYP SSGSRPTSPSSGSRPTYPSSGSRPTYPSSGSRPTYPYTGSRPTPQKPVFPSYQKYPPAVQKYIDSLPSGTQGTLEYTVTQ NGVTTTTYYHFSK
Molecular weight 44,96 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer NaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAK16520.1
Spec:SwissProtID Q9BJL7
NCBI Reference AAK16520.1
Aliases /Synonyms NBL-1-∆Nter, newborn larvae-specific serine protease SS2
Reference PX-P1128
Note For research use only
Molecular Constructor
Partial Yes
Product name Trichinella spiralis NBL-1 Recombinant Protein
Uniprot ID Q9BJL7
Uniprot link http://www.uniprot.org/uniprot/Q9BJL7
Origin species Trichinella spiralis
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLAFECGVPHFKPYIWKSGRIVGGTDVRPHSHPWQIQLLKSETGGYSSLCGGSLVHFGKPSNGTRFVLTAA HCITTSNMYPRTSRFTVVTGAHNIKMHEKEKKRIPITSYYVQHWNPVMTTNDIALLRLAETVYYNEYTRPVCLPEPNEEL TPGDICVVTGWGDTTENGTTSNTLKQVGVKIMKKGTCANVRSEVITFCAGAMEGGKDSCQGDSGGPLICKKNGKSVQFGV VSYGTGCARKGYPGVYAKVPSYVTWLNKAAKELENSPEGTVKWASKEDSPVDLSTASRPTNPYTGSRPTSPSSGSRPTYP SSGSRPTSPSSGSRPTYPSSGSRPTYPSSGSRPTYPYTGSRPTPQKPVFPSYQKYPPAVQKYIDSLPSGTQGTLEYTVTQ NGVTTTTYYHFSK
Molecular weight 44,96 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer NaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAK16520.1
Spec:SwissProtID Q9BJL7
NCBI Reference AAK16520.1
Aliases /Synonyms NBL-1-∆Nter, newborn larvae-specific serine protease SS2
Reference PX-P1128
Note For research use only
Molecular Constructor
Partial Yes

General Information about Trichinella spiralis NBL-1 Recombinant Protein

Trichinella spiralis is an intracellular parasitic nematode of mammalian skeletal muscle, causing a serious zoonotic disease in humans and showing a high economic impact mainly in pig breeding. Serine proteinases of T. spiralis play important roles in the host–parasite interactions mediating host invasion

There are no reviews yet.

Be the first to review “Trichinella spiralis NBL-1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products