Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Polatuzumab Biosimilar – Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb – Research Grade

  • PX-TA1317-50
  • Validated ELISA
Isotype:
IgG1, kappa

Original price was: $121.00.Current price is: $100.00.

50ug 17% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade

Product name Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1317-50
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

General information on Anti-CD79B(CD79b, B29, IGB, Ig-beta)[Homo sapiens] (Polatuzumab) Monoclonal Antibody

Polatuzumab is a humanized IgG1, kappa antibody targetting human CD79B. This antigen is required in the initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR).

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb binds to Human CD79β/CD79B recombinant protein in indirect ELISA Assay

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb binds to Human CD79β/CD79B recombinant protein in indirect ELISA Assay

Immobilized Human CD79β/CD79B recombinant protein (cat. No.PX-P6276) at 0.5µg/mL (100µL/well) can bind to Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb (cat. No.PX-TA1317) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade

There are no reviews yet.

Be the first to review “Polatuzumab Biosimilar – Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products