Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Beta-lactoglobulin(LGB)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P02754
Molecular weight:
21.56KDa

$392.00

100ug + 392 loyalty points
Lys17–Ile178
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Beta-lactoglobulin(LGB)

Product name Beta-lactoglobulin(LGB)
Uniprot ID P02754
Uniprot link https://www.uniprot.org/uniprot/P02754
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAMAGSHHHHHHSGLIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight 21.56KDa
Purity estimated 55% by SDS-PAGE
Buffer TBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys17-Ile178
Aliases /Synonyms LGB/Beta-lactoglobulin
Reference PX-P4394
Note For research use only
Molecular Constructor
Lys17–Ile178
Product name Beta-lactoglobulin(LGB)
Uniprot ID P02754
Uniprot link https://www.uniprot.org/uniprot/P02754
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAMAGSHHHHHHSGLIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight 21.56KDa
Purity estimated 55% by SDS-PAGE
Buffer TBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys17-Ile178
Aliases /Synonyms LGB/Beta-lactoglobulin
Reference PX-P4394
Note For research use only
Molecular Constructor
Lys17–Ile178

There are no reviews yet.

Be the first to review “Beta-lactoglobulin(LGB)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products