Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Placenta-specific protein 1(PLAC1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9HBJ0
Molecular weight:
48.75kDa

Original price was: $275.00.Current price is: $217.00.

50ug 21% OFF + 217 loyalty points
Gln23–Met212
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Placenta-specific protein 1(PLAC1)

Product name Placenta-specific protein 1(PLAC1)
Uniprot ID Q9HBJ0
Uniprot link https://www.uniprot.org/uniprot/Q9HBJ0
Expression system Prokaryotic expression
Raw Antigen Sequence GSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGS
Molecular weight 48.75kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln23-Met212
Reference PX-P4344
Note For research use only
Molecular Constructor
Gln23–Met212
Product name Placenta-specific protein 1(PLAC1)
Uniprot ID Q9HBJ0
Uniprot link https://www.uniprot.org/uniprot/Q9HBJ0
Expression system Prokaryotic expression
Raw Antigen Sequence GSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGS
Molecular weight 48.75kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln23-Met212
Reference PX-P4344
Note For research use only
Molecular Constructor
Gln23–Met212
Product name PX-P4344-1MG
Uniprot ID Q9HBJ0
Uniprot link https://www.uniprot.org/uniprot/Q9HBJ0
Expression system Prokaryotic expression
Raw Antigen Sequence GSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGS
Molecular weight 48.75kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln23-Met212
Reference PX-P4344
Note For research use only
Molecular Constructor
Gln23–Met212

General information on Placenta-specific protein 1(PLAC1):

Placenta-specific protein 1 is a small secreted cell surface protein (212 amino acids) encoded by the PLAC1 gene on the X chromosome. Since its discovery in 1999, PLAC1 has played a role in the development and maintenance of the placenta, including preeclampsia, fetal development, and many cancers.

Placenta-specific protein 1(PLAC1)

There are no reviews yet.

Be the first to review “Placenta-specific protein 1(PLAC1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products