Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Golgi membrane protein 1 (GP73) recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q8NBJ4
Molecular weight:
42.35kDa

Original price was: $307.00.Current price is: $250.00.

50ug 19% OFF + 250 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Golgi membrane protein 1 (GP73) recombinant protein

Product name Human Golgi membrane protein 1 (GP73) recombinant protein
Uniprot ID Q8NBJ4
Uniprot link http://www.uniprot.org/uniprot/Q8NBJ4
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Molecular weight 42.35kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms GOLM1, GOLPH2, C9orf155, Golgi Membrane Protein 1, Golgi Phosphoprotein 2, GP73
Reference PX-P4051
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Golgi membrane protein 1 (GP73) recombinant protein
Uniprot ID Q8NBJ4
Uniprot link http://www.uniprot.org/uniprot/Q8NBJ4
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Molecular weight 42.35kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms GOLM1, GOLPH2, C9orf155, Golgi Membrane Protein 1, Golgi Phosphoprotein 2, GP73
Reference PX-P4051
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4051-1MG
Uniprot ID Q8NBJ4
Uniprot link http://www.uniprot.org/uniprot/Q8NBJ4
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Molecular weight 42.35kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms GOLM1, GOLPH2, C9orf155, Golgi Membrane Protein 1, Golgi Phosphoprotein 2, GP73
Reference PX-P4051
Note For research use only
Molecular Constructor
Partial Yes

General Information about Human Golgi membrane protein 1 (GP73) recombinant protein

Golgi complex plays a key role in the ordering and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is the Golgi type II transmembrane protein. It processes the proteins synthesized in the rough endoplasmic reticulum and aids in the transport of the protein load through the Golgi apparatus. It has been observed that the expression of this gene is regulated by viral infection. Alternatively, an explicit transcription code encoding the same protein has been described for this gene.

Human Golgi membrane protein 1 (GP73) recombinant protein

There are no reviews yet.

Be the first to review “Human Golgi membrane protein 1 (GP73) recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products