Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mite allergen Blo t 5(BLOT5)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O96870
Molecular weight:
16.22KDa

Original price was: $264.00.Current price is: $217.00.

50ug 18% OFF + 217 loyalty points
Gln18–Gln134
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mite allergen Blo t 5(BLOT5)

Product name Mite allergen Blo t 5(BLOT5)
Uniprot ID O96870
Uniprot link https://www.uniprot.org/uniprot/O96870
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Molecular weight 16.22KDa
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mMNaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Gln134
Aliases /Synonyms BLOT5/Mite allergen Blo t
Reference PX-P4389
Note For research use only
Molecular Constructor
Gln18–Gln134
Product name Mite allergen Blo t 5(BLOT5)
Uniprot ID O96870
Uniprot link https://www.uniprot.org/uniprot/O96870
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Molecular weight 16.22KDa
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mMNaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Gln134
Aliases /Synonyms BLOT5/Mite allergen Blo t
Reference PX-P4389
Note For research use only
Molecular Constructor
Gln18–Gln134
Product name PX-P4389-1MG
Uniprot ID O96870
Uniprot link https://www.uniprot.org/uniprot/O96870
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Molecular weight 16.22KDa
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mMNaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Gln134
Aliases /Synonyms BLOT5/Mite allergen Blo t
Reference PX-P4389
Note For research use only
Molecular Constructor
Gln18–Gln134

Mite allergen Blo t 5(BLOT5)

There are no reviews yet.

Be the first to review “Mite allergen Blo t 5(BLOT5)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products