Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gevokizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Gevokizumab ELISA Kit

Gevokizumab ELISA Kit

Product name Gevokizumab ELISA Kit
Uniprot ID P01584
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX132
Note For research use only.
Sample type Plasma, Serum
Target Gevokizumab
Immunogen Gevokizumab

Gevokizumab ELISA Kit Introduction

Gevokizumab is a humanized monoclonal antibody that targets the pro-inflammatory cytokine interleukin-1 beta (IL-1β). It is currently being studied as a potential therapeutic option for various inflammatory diseases, including rheumatoid arthritis, psoriasis, and Crohn’s disease. The Gevokizumab ELISA Kit is a specialized tool used for the detection and quantification of gevokizumab in biological samples.

Structure of Gevokizumab

Gevokizumab is a recombinant human IgG1 kappa monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of gevokizumab specifically binds to IL-1β, while the constant region allows for effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Gevokizumab

Gevokizumab works by binding to IL-1β and blocking its interaction with its receptor, IL-1R. This prevents the activation of downstream signaling pathways that lead to the production of pro-inflammatory cytokines, such as IL-6 and TNF-α. By inhibiting IL-1β, gevokizumab helps to reduce inflammation and alleviate symptoms associated with inflammatory diseases.

Application of Gevokizumab ELISA Kit

The Gevokizumab ELISA Kit is a valuable tool for researchers and clinicians studying the pharmacokinetics and pharmacodynamics of gevokizumab. It allows for the accurate and sensitive detection of gevokizumab in various biological samples, such as serum, plasma, and cell culture supernatants. This information can be used to determine the optimal dosage and dosing regimen for gevokizumab treatment, as well as to monitor drug levels and assess patient response.

Quantification of Gevokizumab

The Gevokizumab ELISA Kit utilizes a sandwich enzyme-linked immunosorbent assay (ELISA) format for the quantification of gevokizumab. In this assay, a capture antibody specific for gevokizumab is coated onto a microplate. The sample, along with a known amount of gevokizumab standard, is added to the plate and incubated. Any gevokizumab present in the sample will bind to the capture antibody. After washing away any unbound substances, a detection antibody labeled with an enzyme is added. This detection antibody will bind to the gevokizumab-capture antibody complex, forming a sandwich. The amount of enzyme present is then measured using a colorimetric or chemiluminescent substrate, which is directly proportional to the amount of gevokizumab present in the sample.

Sensitivity and Specificity

The Gevokizumab ELISA Kit has a high sensitivity, with a lower limit of detection of 0.1 ng/mL. This allows for the accurate detection of gevokizumab even at low concentrations. The kit also has a high specificity, with minimal cross-reactivity to other antibodies or proteins, ensuring accurate and reliable results.

Advantages of Gevokizumab ELISA Kit

The Gevokizumab ELISA Kit offers several advantages over other methods of detecting gevokizumab, such as Western blotting or flow cytometry. It is a simple and cost-effective method that can be easily performed in most laboratory settings. It also has a high throughput, allowing for the analysis of

Gevokizumab ELISA Kit

There are no reviews yet.

Be the first to review “Gevokizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products