Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Prasinezumab Biosimilar – Anti-SNCA mAb – Research Grade

  • PX-TA1491-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $207.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade

Product name Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade
Uniprot ID P37840
Source CAS 1960462-19-4
Species Humanized
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Prasinezumab,PRX002,RG-7935,SNCA,anti-SNCA
Reference PX-TA1491
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade
Uniprot ID P37840
Source CAS 1960462-19-4
Species Humanized
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Prasinezumab,PRX002,RG-7935,SNCA,anti-SNCA
Reference PX-TA1491
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1491-50
Uniprot ID P37840
Source CAS 1960462-19-4
Species Humanized
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Prasinezumab,PRX002,RG-7935,SNCA,anti-SNCA
Reference PX-TA1491
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Prasinezumab Biosimilar, also known as Anti-SNCA mAb, is a monoclonal antibody that targets the protein alpha-synuclein (SNCA). This protein is abundant in the brain and is believed to play a role in the development of Parkinson’s disease. Prasinezumab Biosimilar is currently being studied as a potential therapeutic option for this neurodegenerative disorder.

Structure of Prasinezumab Biosimilar

Prasinezumab Biosimilar is a recombinant monoclonal antibody that is produced in a laboratory setting. It is designed to mimic the structure of the natural human antibody and is composed of two heavy chains and two light chains. These chains are connected by disulfide bonds and are responsible for the antibody’s specificity and binding capabilities.

Mechanism of Action

Prasinezumab Biosimilar works by specifically binding to alpha-synuclein, which is a key protein involved in the formation of Lewy bodies, a hallmark of Parkinson’s disease. By binding to alpha-synuclein, Prasinezumab Biosimilar prevents its aggregation and accumulation, which is believed to contribute to the degeneration of neurons in the brain. This mechanism of action has the potential to slow down or even halt the progression of Parkinson’s disease.

Research Grade

Prasinezumab Biosimilar is currently in the research grade stage, which means it is being studied in preclinical and clinical trials to determine its safety and efficacy. These studies involve testing the antibody in animal models and human subjects to gather data on its pharmacokinetics, pharmacodynamics, and potential side effects. The results of these studies will inform the development of the antibody for potential use as a therapeutic option for Parkinson’s disease.

Potential Applications

If Prasinezumab Biosimilar proves to be effective in clinical trials, it has the potential to be used as a treatment for Parkinson’s disease. This could provide a much-needed alternative to current treatments, which primarily focus on managing symptoms rather than slowing down the progression of the disease. Prasinezumab Biosimilar could also potentially be used as a preventive therapy for individuals at risk of developing Parkinson’s disease, such as those with a family history of the disorder.

Conclusion

In summary, Prasinezumab Biosimilar is a promising monoclonal antibody that targets alpha-synuclein, a key protein involved in the development of Parkinson’s disease. Its unique mechanism of action has the potential to slow down or even halt the progression of the disease, making it a potential breakthrough in the treatment of this neurodegenerative disorder. As it continues to be studied in research grade trials, Prasinezumab Biosimilar may offer new hope for individuals living with Parkinson’s disease and their families.

SDS-PAGE for Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade

SDS-PAGE for Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade in WB Assay

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade in WB Assay

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade

There are no reviews yet.

Be the first to review “Prasinezumab Biosimilar – Anti-SNCA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products