Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Alpha-synuclein(SNCA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P37840
Molecular weight:
14.46 kDa

Original price was: $238.00.Current price is: $217.00.

50ug 9% OFF + 217 loyalty points
His Met1–Ala140
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Alpha-synuclein(SNCA)

Product name Alpha-synuclein(SNCA)
Uniprot ID P37840
Uniprot link https://www.uniprot.org/uniprot/P37840
Expression system Prokaryotic expression
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Molecular weight 14.46 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala140
Protein Accession P37840
Spec:Entrez GeneID 6622
Spec:NCBI Gene Aliases NACP; PARK1; PARK4
Spec:SwissProtID Q13701
NCBI Reference P37840
Aliases /Synonyms Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP,NACP, PARK1
Reference PX-P4717
Note For research use only
Molecular Constructor
His Met1–Ala140
Product name Alpha-synuclein(SNCA)
Uniprot ID P37840
Uniprot link https://www.uniprot.org/uniprot/P37840
Expression system Prokaryotic expression
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Molecular weight 14.46 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala140
Protein Accession P37840
Spec:Entrez GeneID 6622
Spec:NCBI Gene Aliases NACP; PARK1; PARK4
Spec:SwissProtID Q13701
NCBI Reference P37840
Aliases /Synonyms Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP,NACP, PARK1
Reference PX-P4717
Note For research use only
Molecular Constructor
His Met1–Ala140
Product name PX-P4717-1MG
Uniprot ID P37840
Uniprot link https://www.uniprot.org/uniprot/P37840
Expression system Prokaryotic expression
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Molecular weight 14.46 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala140
Protein Accession P37840
Spec:Entrez GeneID 6622
Spec:NCBI Gene Aliases NACP; PARK1; PARK4
Spec:SwissProtID Q13701
NCBI Reference P37840
Aliases /Synonyms Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP,NACP, PARK1
Reference PX-P4717
Note For research use only
Molecular Constructor
His Met1–Ala140

Alpha-synuclein(SNCA)

There are no reviews yet.

Be the first to review “Alpha-synuclein(SNCA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products