Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cinpanemab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Cinpanemab ELISA Kit

Cinpanemab ELISA Kit

Product name Cinpanemab ELISA Kit
Uniprot ID P37840
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX227
Note For research use only.
Sample type Plasma, Serum
Target Cinpanemab
Immunogen Cinpanemab

Introduction

The Cinpanemab ELISA Kit is a highly sensitive and specific assay designed for the detection of Cinpanemab, a novel therapeutic antibody. This kit is specifically designed for the quantification of Cinpanemab in biological samples, making it an essential tool for researchers and clinicians studying its structure, activity, and potential applications.

Structure of Cinpanemab

Cinpanemab is a humanized monoclonal antibody that targets the interleukin-6 receptor (IL-6R). It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the IL-6R, while the constant region determines its effector functions.

The Cinpanemab ELISA Kit utilizes a sandwich immunoassay format, where the capture antibody is coated onto the microplate wells and the detection antibody is labeled with an enzyme. This allows for the specific and sensitive detection of Cinpanemab in biological samples.

Activity of Cinpanemab

Cinpanemab works by binding to the IL-6R and inhibiting its signaling pathway. IL-6 is a cytokine that plays a crucial role in inflammation and immune responses. Overexpression of IL-6 has been linked to various diseases, including rheumatoid arthritis, systemic lupus erythematosus, and certain cancers. By blocking IL-6 signaling, Cinpanemab can potentially treat these diseases.

The activity of Cinpanemab can be measured using the Cinpanemab ELISA Kit. The kit provides a quantitative measurement of the amount of Cinpanemab present in a sample, allowing researchers to study its pharmacokinetics and pharmacodynamics. This information is crucial for understanding the efficacy and safety of Cinpanemab as a therapeutic agent.

Application of Cinpanemab

The potential applications of Cinpanemab are vast, given its ability to target IL-6, a cytokine involved in various diseases. One of the main applications of Cinpanemab is in the treatment of autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. By inhibiting IL-6 signaling, Cinpanemab can reduce inflammation and alleviate symptoms of these diseases.

Cinpanemab also has potential in the treatment of certain cancers. IL-6 has been shown to play a role in the growth and survival of cancer cells. By blocking IL-6 signaling, Cinpanemab can potentially inhibit the growth and spread of cancer cells. Clinical trials are currently underway to evaluate the efficacy of Cinpanemab in treating various types of cancer.

Furthermore, Cinpanemab may also have a role in the treatment of other inflammatory conditions, such as cytokine release syndrome, a potentially life-threatening complication of certain immunotherapies. By targeting IL-6, Cinpanemab can potentially reduce the severity of cytokine release syndrome and improve patient outcomes.

Conclusion

The Cinpanemab ELISA Kit is a valuable tool for studying the structure, activity, and potential applications of Cinpanemab. By providing a sensitive and specific measurement of Cinpanemab, this kit allows researchers and clinicians to gain a better understanding of this novel therapeutic antibody and its potential in treating various diseases. As more studies and clinical trials are conducted, the use of Cinpanemab may expand to include even more applications, making it a promising therapeutic target for the future.

Cinpanemab ELISA Kit

There are no reviews yet.

Be the first to review “Cinpanemab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products