Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cusatuzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Cusatuzumab ELISA Kit

Cusatuzumab ELISA Kit

Product name Cusatuzumab ELISA Kit
Uniprot ID P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX221
Note For research use only.
Sample type Plasma, Serum
Target Cusatuzumab
Immunogen Cusatuzumab

Introduction

Cusatuzumab is a novel monoclonal antibody that has shown promising results in the treatment of acute myeloid leukemia (AML). To aid in the development and monitoring of this therapeutic agent, a Cusatuzumab ELISA Kit has been developed. This kit allows for the accurate measurement of cusatuzumab levels in biological samples, providing valuable information on the structure, activity, and application of this antibody.

Structure of Cusatuzumab

Cusatuzumab is a humanized IgG1 monoclonal antibody, meaning it is derived from human antibodies and has been modified to reduce immunogenicity. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. Cusatuzumab specifically targets and binds to the extracellular domain of the receptor tyrosine kinase CD70, which is overexpressed in AML cells.

Activity of Cusatuzumab

The binding of cusatuzumab to CD70 has been shown to induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) in AML cells. This results in the destruction of CD70-positive AML cells, leading to a decrease in tumor burden. In addition, cusatuzumab has been found to inhibit the proliferation of AML cells and induce apoptosis, further contributing to its anti-tumor activity.

Application of Cusatuzumab ELISA Kit

The Cusatuzumab ELISA Kit is a valuable tool for the development and monitoring of cusatuzumab therapy. It allows for the accurate measurement of cusatuzumab levels in serum, plasma, and other biological samples. This information can be used to optimize dosing regimens and monitor patient response to treatment.

Development of Cusatuzumab Therapy

The Cusatuzumab ELISA Kit can aid in the development of cusatuzumab therapy by providing information on the pharmacokinetics and pharmacodynamics of the antibody. By measuring cusatuzumab levels at various time points after administration, researchers can determine the optimal dose and dosing frequency for maximum efficacy.

Monitoring of Cusatuzumab Therapy

The Cusatuzumab ELISA Kit can also be used to monitor patient response to cusatuzumab therapy. By measuring cusatuzumab levels in patient samples, clinicians can assess the drug’s bioavailability and determine if any adjustments need to be made to the treatment regimen. In addition, monitoring cusatuzumab levels can provide valuable information on the development of resistance to the antibody.

Research and Development

The Cusatuzumab ELISA Kit can also be used in research and development to study the pharmacokinetics and pharmacodynamics of cusatuzumab in different disease models. This can aid in the understanding of the antibody’s mechanism of action and potential for use in other therapeutic indications.

Limitations of Cusatuzumab ELISA Kit

While the Cusatuzumab ELISA Kit is a valuable tool, it does have some limitations. It can only measure the total amount of cusatuzumab in a sample, and not differentiate between the active and inactive forms of the antibody. In addition, the kit may not be suitable for samples with high levels of endogenous immunoglobulins, which can interfere with the accuracy of the results.

Conclusion

The Cusatuzumab ELISA Kit is a crucial tool for the development and monitoring of cusatuzumab therapy. By accurately measuring cusatuzumab levels, this kit provides valuable information on the structure, activity, and application of this novel monoclonal antibody. With further research and development, cusatuzumab has the potential to become a promising therapeutic

Cusatuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Cusatuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products