Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD70 (27B3) Monoclonal Antibody

  • ARO-A15772-50
  • Validated FC

Original price was: $333.00.Current price is: $275.00.

50ug 17% OFF + 275 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Human CD70 (27B3) Monoclonal Antibody
Human CD70 (27B3) Monoclonal Antibody

Human CD70 (27B3) Monoclonal Antibody

Product name ARO-A15772-100
Uniprot ID P32970
Uniprot link P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD27 ligand, CD70, TNFSF7, CD27LG, CD27L, CD70 antigen, Tumor necrosis factor ligand superfamily member 7, CD27-L
Reference ARO-A15772
Isotype IgG1, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD70 (27B3)
Clone Name 27B3
Protein Name CD70 (27B3)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15772-1MG
Uniprot ID P32970
Uniprot link P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD27 ligand, CD70, TNFSF7, CD27LG, CD27L, CD70 antigen, Tumor necrosis factor ligand superfamily member 7, CD27-L
Reference ARO-A15772
Isotype IgG1, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD70 (27B3)
Clone Name 27B3
Protein Name CD70 (27B3)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15772-50
Uniprot ID P32970
Uniprot link P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD27 ligand, CD70, TNFSF7, CD27LG, CD27L, CD70 antigen, Tumor necrosis factor ligand superfamily member 7, CD27-L
Reference ARO-A15772
Isotype IgG1, lambda
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD70 (27B3)
Clone Name 27B3
Protein Name CD70 (27B3)
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human CD70 (27B3) Monoclonal Antibody

Flow Cytometry results for Human CD70 (27B3) Monoclonal Antibody

Flow-cytometry using anti-human CD70 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an anti-human CD70 monoclonal antibody (Catalog: ARO-A15772) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a Goat Anti-Mouse IgG H&L Polyclonal Antibody, FITC (abinScience: PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Human CD70 (27B3) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD70 (27B3) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products