Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cusatuzumab Biosimilar – Anti-CD70, TNFSF7 mAb – Research Grade

  • PX-TA1500-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

Product name Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade
Uniprot ID P32970
Source CAS 1399546-01-0
Species Humanized
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Cusatuzumab,ARGX-110,CD70, TNFSF7,anti-CD70, TNFSF7
Reference PX-TA1500
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade
Uniprot ID P32970
Source CAS 1399546-01-0
Species Humanized
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Cusatuzumab,ARGX-110,CD70, TNFSF7,anti-CD70, TNFSF7
Reference PX-TA1500
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1500-50
Uniprot ID P32970
Source CAS 1399546-01-0
Species Humanized
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Cusatuzumab,ARGX-110,CD70, TNFSF7,anti-CD70, TNFSF7
Reference PX-TA1500
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Cusatuzumab Biosimilar, also known as Anti-CD70 or TNFSF7 mAb, is a monoclonal antibody that targets the protein CD70, which is a member of the tumor necrosis factor (TNF) superfamily. This biosimilar is a research grade version of the original Cusatuzumab antibody and has been developed for use in scientific studies and experiments.

Structure of Cusatuzumab Biosimilar

Cusatuzumab Biosimilar is a humanized monoclonal antibody, meaning it is derived from human cells and has been engineered to have a high affinity for CD70. It is composed of two heavy chains and two light chains, each with a specific amino acid sequence that determines its binding properties. The antibody has a molecular weight of approximately 150 kDa and is produced through recombinant DNA technology.

Activity of Cusatuzumab Biosimilar

The primary function of Cusatuzumab Biosimilar is to bind to the CD70 protein and block its activity. CD70 is a cell surface receptor that is overexpressed in various types of cancer, including lymphoma, leukemia, and solid tumors. By binding to CD70, Cusatuzumab Biosimilar inhibits its interaction with its receptor, CD27, which is present on the surface of immune cells. This prevents the activation of CD70 and its downstream signaling pathways, which are involved in cell proliferation and survival.

In addition to blocking CD70, Cusatuzumab Biosimilar also has other mechanisms of action that contribute to its anti- cancer activity. It can induce antibody-dependent cellular cytotoxicity (ADCC), where immune cells recognize and kill cancer cells that are bound by the antibody. It can also trigger apoptosis, or programmed cell death, in cancer cells by activating caspase enzymes.

Application of Cusatuzumab Biosimilar

Cusatuzumab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials as a potential treatment for various types of cancer. It has been granted orphan drug designation by the FDA for the treatment of acute myeloid leukemia (AML) and is also being studied for the treatment of multiple myeloma, diffuse large B-cell lymphoma, and other solid tumors.

In addition to its use as a potential therapeutic, Cusatuzumab Biosimilar is also widely used in research settings. Its high specificity for CD70 makes it a valuable tool for studying the role of this protein in cancer development and progression. It can also be used to evaluate the effectiveness of other targeted therapies that may be used in combination with Cusatuzumab Biosimilar.

Conclusion

Cusatuzumab Biosimilar is a research grade monoclonal antibody that specifically targets CD70, a protein that is overexpressed in various types of cancer. Its primary function is to block the activity of CD70, but it also has other mechanisms of action that contribute to its anti- cancer activity. This biosimilar is currently being evaluated in clinical trials and has potential as a treatment for multiple types of cancer. Its high specificity and effectiveness make it a valuable tool for research purposes as well.

Keywords: antibody, therapeutic target, Cusatuzumab Biosimilar, Anti-CD70, TNFSF7 mAb, monoclonal antibody, CD70, tumor necrosis factor, research grade, preclinical studies, clinical trials, cancer, orphan drug designation, acute myeloid leukemia, multiple myeloma, diffuse large B-cell lymphoma, solid tumors, specificity, targeted therapy, combination therapy.

SDS-PAGE for Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

SDS-PAGE for Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Cusatuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade in ELISA Assay

Cusatuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade in ELISA Assay

Cusatuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Cusatuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

There are no reviews yet.

Be the first to review “Cusatuzumab Biosimilar – Anti-CD70, TNFSF7 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products