Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gimsilumab Biosimilar – Anti-CSF2 , GM-CSF mAb – Research Grade

  • PX-TA1478-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $221.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Gimsilumab Biosimilar - Anti-CSF2 , GM-CSF mAb - Research Grade

Product name Gimsilumab Biosimilar - Anti-CSF2 , GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1648796-29-5
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gimsilumab,MORAb-022,CSF2 , GM-CSF,anti-CSF2 , GM-CSF
Reference PX-TA1478
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Gimsilumab Biosimilar - Anti-CSF2 , GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1648796-29-5
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gimsilumab,MORAb-022,CSF2 , GM-CSF,anti-CSF2 , GM-CSF
Reference PX-TA1478
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1478-50
Uniprot ID P04141
Source CAS 1648796-29-5
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gimsilumab,MORAb-022,CSF2 , GM-CSF,anti-CSF2 , GM-CSF
Reference PX-TA1478
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Gimsilumab Biosimilar: A Promising Antibody Targeting GM-CSF

Gimsilumab Biosimilar, also known as Anti-CSF2, is a research grade monoclonal antibody (mAb) that specifically targets granulocyte-macrophage colony-stimulating factor (GM-CSF). This antibody has shown great potential in the treatment of various inflammatory and autoimmune diseases, making it a promising therapeutic target.

Structure of Gimsilumab Biosimilar

Gimsilumab Biosimilar is a fully human IgG1 monoclonal antibody, produced through recombinant DNA technology. It consists of two heavy chains and two light chains, each containing a variable region that specifically binds to GM-CSF. The constant region of the antibody allows for interactions with immune cells and other components of the immune system.

The crystal structure of Gimsilumab Biosimilar has been extensively studied, revealing the precise binding site of the antibody on GM-CSF. This information has helped in the development of more potent versions of the antibody, with improved binding affinity and specificity.

Activity of Gimsilumab Biosimilar

Gimsilumab Biosimilar exerts its activity by specifically binding to GM-CSF, a cytokine that plays a crucial role in the development and function of immune cells. By binding to GM-CSF, Gimsilumab Biosimilar blocks its interaction with its receptor, inhibiting the downstream signaling pathways that lead to inflammation and autoimmune responses.

In preclinical studies, Gimsilumab Biosimilar has shown to effectively reduce the levels of pro-inflammatory cytokines, such as interleukin-6 and tumor necrosis factor-alpha, in various disease models. This highlights the potential of this antibody in treating a wide range of inflammatory and autoimmune conditions.

Application of Gimsilumab Biosimilar

Gimsilumab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of different inflammatory and autoimmune diseases. Some of the conditions being targeted include rheumatoid arthritis, asthma, and multiple sclerosis.

In a phase II clinical trial for rheumatoid arthritis, Gimsilumab Biosimilar demonstrated a significant reduction in disease activity and improved symptoms in patients who had an inadequate response to traditional therapies. This suggests that Gimsilumab Biosimilar could be a potential treatment option for patients with this debilitating condition.

Furthermore, Gimsilumab Biosimilar has also shown promising results in treating asthma, a chronic respiratory disease characterized by airway inflammation. In a phase II clinical trial, Gimsilumab Biosimilar significantly reduced asthma exacerbations and improved lung function in patients with severe asthma. This highlights the potential of this antibody in managing severe and difficult-to-treat asthma cases.

Conclusion

Gimsilumab Biosimilar, a research grade monoclonal antibody targeting GM-CSF, has shown great potential in the treatment of various inflammatory and autoimmune diseases. Its specific binding to GM-CSF and subsequent inhibition of inflammatory pathways make it a promising therapeutic target. With ongoing clinical trials and further research, Gimsilumab Biosimilar has the potential to provide relief to patients suffering from a wide range of chronic and debilitating conditions.

SDS-PAGE for Gimsilumab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade

SDS-PAGE for Gimsilumab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade

Gimsilumab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Gimsilumab Biosimilar - Anti-CSF2 , GM-CSF mAb - Research Grade

There are no reviews yet.

Be the first to review “Gimsilumab Biosimilar – Anti-CSF2 , GM-CSF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products