Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ianalumab Biosimilar – Anti-TNFRSF13C, CD268 mAb – Research Grade

  • PX-TA1480-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $201.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ianalumab Biosimilar - Anti-TNFRSF13C, CD268 mAb - Research Grade

Product name Ianalumab Biosimilar - Anti-TNFRSF13C, CD268 mAb - Research Grade
Uniprot ID Q96RJ3
Source CAS 1929549-92-7
Species Homo sapiens
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ianalumab,VAY-736,TNFRSF13C, CD268,anti-TNFRSF13C, CD268
Reference PX-TA1480
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Ianalumab Biosimilar - Anti-TNFRSF13C, CD268 mAb - Research Grade
Uniprot ID Q96RJ3
Source CAS 1929549-92-7
Species Homo sapiens
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ianalumab,VAY-736,TNFRSF13C, CD268,anti-TNFRSF13C, CD268
Reference PX-TA1480
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1480-50
Uniprot ID Q96RJ3
Source CAS 1929549-92-7
Species Homo sapiens
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ianalumab,VAY-736,TNFRSF13C, CD268,anti-TNFRSF13C, CD268
Reference PX-TA1480
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction:

Ianalumab Biosimilar, also known as Anti-TNFRSF13C or CD268 mAb, is a research grade monoclonal antibody that has been developed as a potential therapeutic agent for various diseases. This antibody specifically targets the tumor necrosis factor receptor superfamily member 13C (TNFRSF13C), also known as CD268, which is a cell surface protein involved in immune responses and inflammation. In this article, we will discuss the structure, activity, and potential applications of Ianalumab Biosimilar.

Structure of Ianalumab Biosimilar:

Ianalumab Biosimilar is a monoclonal antibody that is produced through recombinant DNA technology. It is a humanized antibody, meaning that it is derived from non-human sources but has been modified to be more similar to human antibodies. This modification reduces the likelihood of an immune response when used in therapeutic applications.

The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. Each chain contains a variable region and a constant region. The variable region is responsible for binding to the target protein, while the constant region determines the antibody’s effector functions.

Activity of Ianalumab Biosimilar:

Ianalumab Biosimilar is a potent inhibitor of TNFRSF13C, which is a cell surface receptor that is expressed on various immune cells, including B cells, T cells, and dendritic cells. TNFRSF13C plays a critical role in regulating the immune response, and its dysregulation has been linked to various diseases, including autoimmune disorders, cancer, and chronic inflammation.

By binding to TNFRSF13C, Ianalumab Biosimilar blocks its interaction with its ligand, BAFF (B-cell activating factor), thereby preventing the activation of downstream signaling pathways. This results in the inhibition of B cell survival, proliferation, and differentiation, leading to a decrease in autoantibody production and inflammation.

Applications of Ianalumab Biosimilar:

Due to its ability to target TNFRSF13C, Ianalumab Biosimilar has potential applications in the treatment of various diseases. Some of the potential therapeutic areas where this antibody could be used include:

1.

Autoimmune disorders: TNFRSF13C has been implicated in the development of autoimmune disorders such as systemic lupus erythematosus (SLE), rheumatoid arthritis, and Sjogren’s syndrome. By inhibiting TNFRSF13C, Ianalumab Biosimilar could potentially reduce disease activity and symptoms in these conditions.

2.

Cancer: TNFRSF13C has also been found to be overexpressed in certain types of cancer, such as multiple myeloma and non-Hodgkin’s lymphoma. By targeting this receptor, Ianalumab Biosimilar could potentially inhibit tumor growth and survival.

3. Chronic inflammatory diseases: TNFRSF13C is involved in the regulation of chronic inflammation, which is a common feature of diseases such as asthma, inflammatory bowel disease, and psoriasis. By blocking TNFRSF13C, Ianalumab Biosimilar could potentially reduce inflammation and improve disease outcomes.

Conclusion:

In conclusion, Ianalumab Biosimilar is a research grade monoclonal antibody that specifically targets TNFRSF13C, a cell surface receptor involved in immune responses and inflammation. This antibody has a unique structure and activity that makes it a promising therapeutic agent for various diseases. Further research and clinical trials are needed to fully understand the potential of Ianalumab Biosimilar in treating different conditions.

SDS-PAGE for Ianalumab Biosimilar - Anti-CD268,TNFRSF13C mAb - Research Grade

SDS-PAGE for Ianalumab Biosimilar - Anti-CD268,TNFRSF13C mAb - Research Grade

Ianalumab Biosimilar - Anti-CD268,TNFRSF13C mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flow Cytometry results for Ianalumab Biosimilar - Anti-CD268;TNFRSF13C mAb - Research Grade

Flow Cytometry results for Ianalumab Biosimilar - Anti-CD268;TNFRSF13C mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Ianalumab Biosimilar - Anti-CD268;TNFRSF13C mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Ianalumab Biosimilar - Anti-TNFRSF13C, CD268 mAb - Research Grade

There are no reviews yet.

Be the first to review “Ianalumab Biosimilar – Anti-TNFRSF13C, CD268 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products