Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ianalumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Ianalumab ELISA Kit

Ianalumab ELISA Kit

Product name Ianalumab ELISA Kit
Uniprot ID Q96RJ3
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX273
Note For research use only.
Sample type Plasma, Serum
Target Ianalumab
Immunogen Ianalumab

Ianalumab ELISA Kit: Structure, Activity, and Application Ianalumab ELISA Kit: Structure, Activity, and Application Introduction

Ianalumab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection and quantification of Ianalumab, a human monoclonal antibody, in various biological samples. This kit is designed to provide accurate and reliable results for researchers and clinicians studying the role of Ianalumab in various diseases.

Structure of Ianalumab

Ianalumab is a fully human IgG1 monoclonal antibody that specifically binds to the interleukin-17A (IL-17A) cytokine. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 50 kDa. The heavy chains are made up of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains consist of one constant region (CL) and one variable region (VL). The VH and VL regions of Ianalumab are responsible for its binding specificity to IL-17A.

Activity of Ianalumab

Ianalumab exerts its activity by specifically binding to IL-17A, a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various autoimmune and inflammatory diseases. By binding to IL-17A, Ianalumab inhibits its interaction with the IL-17 receptor and prevents the downstream signaling cascade, leading to the suppression of IL-17A-mediated inflammation. This activity of Ianalumab makes it a promising therapeutic target for the treatment of diseases such as psoriasis, rheumatoid arthritis, and ankylosing spondylitis.

Application of Ianalumab ELISA Kit

The Ianalumab ELISA Kit is a valuable tool for researchers and clinicians studying the role of Ianalumab in various diseases. It can be used to accurately measure the levels of Ianalumab in different biological samples, including serum, plasma, and cell culture supernatants. The kit is also suitable for the quantification of Ianalumab in pre-clinical and clinical studies, as well as for monitoring the efficacy of Ianalumab therapy in patients.

Detection of Ianalumab in Serum and Plasma Samples

The Ianalumab ELISA Kit utilizes a sandwich enzyme-linked immunosorbent assay (ELISA) technique for the detection and quantification of Ianalumab in serum and plasma samples. The kit contains pre-coated plates with a specific anti-human IgG antibody, which captures Ianalumab present in the sample. After washing away any unbound substances, a detection antibody specific to Ianalumab is added, followed by a secondary enzyme-conjugated antibody. The amount of Ianalumab present in the sample is then determined by measuring the color intensity produced by the enzyme-substrate reaction.

Quantification of Ianalumab in Cell Culture Supernatants

In addition to serum and plasma samples, the Ianalumab ELISA Kit can also be used to measure the levels of Ianalumab in cell culture supernatants. This is particularly useful for researchers studying the production of Ianalumab in cell lines or for monitoring its production during the development of biosimilars.

Monitoring Efficacy of Ianalumab Therapy

The Ianalumab ELISA Kit can also be used to monitor the efficacy of Ianalumab therapy in patients with IL-17A-mediated diseases. By measuring the levels of Ianalumab in patient samples, clinicians can assess the response to treatment and make informed

Ianalumab ELISA Kit

There are no reviews yet.

Be the first to review “Ianalumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products