Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)

  • ARO-A13154-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Mouse

Original price was: $371.00.Current price is: $305.00.

50ug 18% OFF + 305 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)
InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s) binds to Human CD268-TNFRSF13C recombinant protein in ELISA Assay

InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)

Product name ARO-A13154-100
Uniprot ID Q96RJ3
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-BR3, TNFRSF13C, BAFF receptor, BLyS receptor 3, Tumor necrosis factor receptor superfamily member 13C, CD268, B-cell-activating factor receptor, BAFFR, BAFF-R
Reference ARO-A13154
Clonality Monoclonal Antibody
Protein Name BR3
Product name ARO-A13154-1MG
Uniprot ID Q96RJ3
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-BR3, TNFRSF13C, BAFF receptor, BLyS receptor 3, Tumor necrosis factor receptor superfamily member 13C, CD268, B-cell-activating factor receptor, BAFFR, BAFF-R
Reference ARO-A13154
Clonality Monoclonal Antibody
Protein Name BR3
Product name ARO-A13154-50
Uniprot ID Q96RJ3
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-BR3, TNFRSF13C, BAFF receptor, BLyS receptor 3, Tumor necrosis factor receptor superfamily member 13C, CD268, B-cell-activating factor receptor, BAFFR, BAFF-R
Reference ARO-A13154
Clonality Monoclonal Antibody
Protein Name BR3

SDS-PAGE for InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)

SDS-PAGE for InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)

InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s) binds to Human CD268-TNFRSF13C recombinant protein in ELISA Assay

InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s) binds to Human CD268-TNFRSF13C recombinant protein in ELISA Assay

Human CD268-TNFRSF13C recombinant protein(cat. No.PX-P6109) at 0.5µg/mL (100µL/well) can bind InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products