Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD268-TNFRSF13C recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q96RJ3
Molecular weight:
35.79 kDa

$500.00

100ug + 500 loyalty points
Arg2–Ala71 Fc
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD268-TNFRSF13C recombinant protein

Product name Human CD268-TNFRSF13C recombinant protein
Uniprot ID Q96RJ3
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence RRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
Molecular weight 35.79 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg2-Ala71
Aliases /Synonyms BR3, TNFRSF13C, BAFF receptor, BLyS receptor 3, Tumor necrosis factor receptor superfamily member 13C, CD268, B-cell-activating factor receptor, BAFFR, BAFF-R, Drug Target
Reference PX-P6109
Note For research use only
Molecular Constructor
Arg2–Ala71 Fc

Human CD268-TNFRSF13C recombinant protein

There are no reviews yet.

Be the first to review “Human CD268-TNFRSF13C recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products