Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human LGR4 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9BXB1
Molecular weight:
85.79 kDa

$451.00

100ug + 451 loyalty points
Met1–Thr544 Fc
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Human LGR4 recombinant protein
Human LGR4 recombinant protein

Human LGR4 recombinant protein

Product name Human LGR4 recombinant protein
Uniprot ID Q9BXB1
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT
Molecular weight 85.79 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr544
Aliases /Synonyms GPR48, Leucine-rich repeat-containing G-protein coupled receptor 4, LGR4, G-protein coupled receptor 48, Drug Target
Reference PX-P6128
Note For research use only
Molecular Constructor
Met1–Thr544 Fc

SDS-PAGE for Human LGR4 recombinant protein

SDS-PAGE for Human LGR4 recombinant protein

Human LGR4 recombinant protein on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein antibody is superior than 90 %.

Human LGR4 recombinant protein

There are no reviews yet.

Be the first to review “Human LGR4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products