Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rolinsatamab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Rolinsatamab ELISA Kit

Rolinsatamab ELISA Kit

Product name Rolinsatamab ELISA Kit
Uniprot ID P16471
Raw Antigen Sequence MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX199
Note For research use only.
Sample type Plasma, Serum
Target Rolinsatamab
Immunogen Rolinsatamab

Title: Understanding the Structure and Function of Rolinsatamab ELISA Kit: A Powerful Tool for Detecting Therapeutic Antibodies

Introduction:

Rolinsatamab is a novel therapeutic antibody that has shown promising results in the treatment of multiple myeloma. To facilitate the detection and quantification of this antibody, a specialized ELISA kit has been developed. In this article, we will explore the structure, activity, and applications of the Rolinsatamab ELISA Kit.

Structure of Rolinsatamab ELISA Kit:

The Rolinsatamab ELISA Kit is composed of several components that work together to accurately detect and quantify the presence of Rolinsatamab in biological samples. The kit contains a microplate coated with a specific antigen that binds to Rolinsatamab, a blocking solution to prevent non-specific binding, a detection antibody labeled with an enzyme, and a substrate solution that produces a colorimetric signal in the presence of the enzyme.

Activity of Rolinsatamab ELISA Kit:

The Rolinsatamab ELISA Kit utilizes the principle of enzyme-linked immunosorbent assay (ELISA) to detect and quantify the presence of Rolinsatamab. The microplate is first coated with a specific antigen that binds to the Rolinsatamab present in the sample. After blocking any non-specific binding sites, the sample is added to the microplate and incubated. If Rolinsatamab is present in the sample, it will bind to the antigen on the microplate.

Next, the detection antibody labeled with an enzyme is added to the microplate. This antibody specifically binds to Rolinsatamab, forming a sandwich complex. The microplate is then washed to remove any unbound components. Finally, the substrate solution is added, which reacts with the enzyme on the detection antibody to produce a colorimetric signal. The intensity of this signal is directly proportional to the amount of Rolinsatamab present in the sample.

Applications of Rolinsatamab ELISA Kit:

The Rolinsatamab ELISA Kit has several applications in the field of therapeutic antibody research. It can be used to detect and quantify the presence of Rolinsatamab in biological samples, such as serum, plasma, or cell culture supernatant. This allows for the monitoring of Rolinsatamab levels in patients undergoing treatment, as well as in preclinical studies.

Additionally, the Rolinsatamab ELISA Kit can be used to measure the pharmacokinetics and pharmacodynamics of this therapeutic antibody. By accurately quantifying the levels of Rolinsatamab in different biological samples, researchers can gain insights into its distribution, metabolism, and elimination from the body.

Furthermore, the Rolinsatamab ELISA Kit can also be used in the development and quality control of Rolinsatamab-based therapeutics. By measuring the levels of Rolinsatamab in different stages of production, researchers can ensure the consistency and efficacy of the final product.

Conclusion:

In summary, the Rolinsatamab ELISA Kit is a powerful tool for detecting and quantifying the presence of this novel therapeutic antibody. Its structure and activity make it a highly specific and sensitive method for measuring Rolinsatamab levels in different biological samples. With its various applications, the Rolinsatamab ELISA Kit is an essential tool for researchers and clinicians working with this promising therapeutic antibody.

Rolinsatamab ELISA Kit

There are no reviews yet.

Be the first to review “Rolinsatamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products