Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sacituzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Sacituzumab ELISA Kit

Sacituzumab ELISA Kit

Product name Sacituzumab ELISA Kit
Uniprot ID P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX166
Note For research use only.
Sample type Plasma, Serum
Target Sacituzumab
Immunogen Sacituzumab

Introduction to Sacituzumab ELISA Kit

Sacituzumab is a monoclonal antibody that has been developed as a potential therapeutic target for various types of cancer. The Sacituzumab ELISA Kit is a diagnostic tool that allows for the specific detection and quantification of this antibody in biological samples. In this article, we will explore the structure, activity and applications of Sacituzumab ELISA Kit in detail.

Structure of Sacituzumab

Sacituzumab is a humanized IgG1 monoclonal antibody that specifically targets the TROP-2 protein, which is overexpressed in many types of cancer cells. It is composed of two heavy chains and two light chains, linked together by disulfide bonds. The heavy chains consist of four constant domains (CH1-CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL1-CL2) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for the specific binding of Sacituzumab to TROP-2.

Activity of Sacituzumab

The main mechanism of action of Sacituzumab is through its binding to the TROP-2 protein on the surface of cancer cells. This binding leads to the internalization and subsequent destruction of the cancer cells, making Sacituzumab a potential therapeutic agent for various types of cancer. Additionally, Sacituzumab has been shown to induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), further enhancing its anti-tumor activity.

The specificity and potency of Sacituzumab have been extensively studied and confirmed in preclinical and clinical trials. It has shown promising results in the treatment of different types of cancer, including breast, lung, and ovarian cancer. In particular, Sacituzumab has shown significant efficacy in targeting and destroying cancer stem cells, which are known to be resistant to conventional cancer therapies.

Applications of Sacituzumab ELISA Kit

The Sacituzumab ELISA Kit is a valuable tool for the detection and quantification of Sacituzumab in biological samples. It is commonly used in research laboratories and clinical settings for various applications, including:

  • Determination of Sacituzumab levels in patient samples: The ELISA Kit allows for the precise measurement of Sacituzumab levels in patient serum or plasma samples. This information can be used to monitor the efficacy of Sacituzumab treatment and to optimize dosage regimens.
  • Pharmacokinetic studies: The ELISA Kit can also be used to study the pharmacokinetics of Sacituzumab in animal models or human subjects. This information is crucial for understanding the absorption, distribution, metabolism, and excretion of Sacituzumab in the body.
  • Quality control in manufacturing: The ELISA Kit is used by pharmaceutical companies to ensure the quality and consistency of Sacituzumab batches during the manufacturing process.

In addition to these applications, the Sacituzumab ELISA Kit is also a valuable tool for conducting research on the TROP-2 protein and its role in cancer. It can be used to study the expression levels of TROP-2 in different types of cancer cells and to investigate the potential of TROP-2 as a biomarker for cancer diagnosis and treatment.

Conclusion

The Sacituzumab ELISA Kit is a crucial tool for the detection and quantification of Sacituzumab in biological samples. Its high specificity and sensitivity make it a valuable asset in both research and clinical settings. With the increasing interest in Sacituzumab as a potential therapeutic target for cancer, the ELISA Kit will continue to

Sacituzumab ELISA Kit

There are no reviews yet.

Be the first to review “Sacituzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products