Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sacituzumab Biosimilar – Anti-TACSTD2 mAb – Research Grade

  • PX-TA1447-50
  • Validated ELISA FC
Isotype:
IgG1, kappa

Original price was: $140.00.Current price is: $100.00.

50ug 29% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Product name PX-TA1447-50
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade
Uniprot ID P09758
Source CAS 1796566-95-4
Species Humanized
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sacituzumab,hRS7,TACSTD2,anti-TACSTD2
Reference PX-TA1447
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

Sacituzumab Biosimilar: A Promising Anti-TACSTD2 Antibody for Therapeutic Targeting

Sacituzumab Biosimilar is a novel monoclonal antibody (mAb) that specifically targets TACSTD2, also known as tumor-associated calcium signal transducer 2. This therapeutic antibody is a biosimilar version of Sacituzumab Govitecan, a drug approved by the US Food and Drug Administration (FDA) for the treatment of metastatic triple-negative breast cancer. Sacituzumab Biosimilar is currently in the research stage and has shown promising results in preclinical studies as a potential therapy for various types of cancer.

Structure of Sacituzumab Biosimilar

Sacituzumab Biosimilar is a humanized IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region that recognizes the TACSTD2 antigen and a constant region that mediates effector functions. The variable regions of Sacituzumab Biosimilar are derived from the original Sacituzumab Govitecan antibody, while the constant regions are humanized to reduce the risk of immune reactions.

The crystal structure of Sacituzumab Biosimilar has been elucidated through X-ray diffraction analysis, revealing its binding mechanism to TACSTD2. The antibody binds to a specific epitope on the extracellular domain of TACSTD2, blocking its interaction with other proteins and inhibiting downstream signaling pathways that promote tumor growth and metastasis.

Activity of Sacituzumab Biosimilar

Sacituzumab Biosimilar has a dual mechanism of action, making it a potent therapeutic agent for cancer treatment. Firstly, it directly targets and binds to TACSTD2, which is overexpressed in a variety of solid tumors, including breast, lung, ovarian, and pancreatic cancers. This binding leads to internalization of the antibody-antigen complex and subsequent degradation of TACSTD2, resulting in decreased cell proliferation and survival.

Secondly, Sacituzumab Biosimilar is an antibody-drug conjugate (ADC), meaning it is conjugated to a potent chemotherapy drug, SN-38. Once internalized, the antibody releases SN-38, which is a topoisomerase I inhibitor that induces DNA damage and cell death. This targeted delivery of chemotherapy reduces off-target toxicity and enhances the efficacy of the drug.

Application of Sacituzumab Biosimilar

The potential of Sacituzumab Biosimilar as a therapeutic agent has been demonstrated in various preclinical studies. In a mouse model of triple-negative breast cancer, treatment with the antibody significantly inhibited tumor growth and improved overall survival. Similarly, in a mouse model of pancreatic cancer, Sacituzumab Biosimilar showed superior antitumor activity compared to standard chemotherapy.

Moreover, Sacituzumab Biosimilar has also shown promising results in combination with other anticancer therapies. In a preclinical study of ovarian cancer, the combination of Sacituzumab Biosimilar and a PARP inhibitor resulted in increased tumor regression and prolonged survival compared to either treatment alone.

Currently, Sacituzumab Biosimilar is being evaluated in clinical trials for the treatment of various solid tumors, including triple-negative breast cancer, non-small cell lung cancer, and urothelial cancer. The results of these trials will determine its potential as a new treatment option for patients with cancer.

Conclusion

Sacituzumab Biosimilar is a promising anti-TACSTD2 antibody with a unique dual mechanism of action. Its specificity for TACSTD2 and targeted delivery of chemotherapy make it a potential therapy for various types of cancer. Further research and clinical trials are needed to fully evaluate the efficacy and safety of this antibody, but it holds great promise as a novel therapeutic agent for cancer

SDS-PAGE for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

SDS-PAGE for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Sacituzumab Biosimilar - Anti-TACSTD2 mAb binds to Tumor-associated calcium signal transducer 2(TACSTD2) in indirect ELISA Assay

Sacituzumab Biosimilar - Anti-TACSTD2 mAb binds to Tumor-associated calcium signal transducer 2(TACSTD2) in indirect ELISA Assay

Immobilized Tumor-associated calcium signal transducer 2(TACSTD2) (cat. No.PX-P4569) at 0.5µg/mL (100µL/well) can bind to Sacituzumab Biosimilar - Anti-TACSTD2 mAb (cat. No.PX-TA1447) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SEC-HPLC of Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

SEC-HPLC of Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade was analyzed by size exclusion chromatography with UV detection.

Flow Cytometry results for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Flow Cytometry results for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Flow Cytometry results for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Flow Cytometry results for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Flow-cytometry using anti-human TACSTD2 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an anti-human TACSTD2 monoclonal antibody (Catalog PX-TA1447) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Flow Cytometry results for Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

Flow-cytometry using anti-human TACSTD2 antibody. Hela cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human TACSTD2 monoclonal antibody (Catalog PX-TA1447, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a a Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Sacituzumab Biosimilar - Anti-TACSTD2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Sacituzumab Biosimilar – Anti-TACSTD2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products