Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Oxelumab Biosimilar – Anti-TNFSF4, CD252 mAb – Research Grade

  • PX-TA1248-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $218.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade
Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade in WB Assay
Oxelumab Biosimilar - Anti-TNFSF4, CD252 mAb - Research Grade

Oxelumab Biosimilar - Anti-TNFSF4, CD252 mAb - Research Grade

Product name Oxelumab Biosimilar - Anti-TNFSF4, CD252 mAb - Research Grade
Uniprot ID P23510
Source CAS 1186098-83-8
Species Homo sapiens
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Oxelumab,R4930,RG4930,RO4989991,huMAb OX40L,TNFSF4, CD252,anti-TNFSF4, CD252
Reference PX-TA1248
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Oxelumab Biosimilar - Anti-TNFSF4, CD252 mAb - Research Grade
Uniprot ID P23510
Source CAS 1186098-83-8
Species Homo sapiens
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Oxelumab,R4930,RG4930,RO4989991,huMAb OX40L,TNFSF4, CD252,anti-TNFSF4, CD252
Reference PX-TA1248
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1248-50
Uniprot ID P23510
Source CAS 1186098-83-8
Species Homo sapiens
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Oxelumab,R4930,RG4930,RO4989991,huMAb OX40L,TNFSF4, CD252,anti-TNFSF4, CD252
Reference PX-TA1248
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-TNFSF4/CD252[Homo sapiens] (Oxelumab) Monoclonal Antibody

Oxelumab is investigated for the treatment of Mild Allergic Asthma.

SDS-PAGE for Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade

SDS-PAGE for Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade

Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade in WB Assay

Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade in WB Assay

Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

Oxelumab Biosimilar - Anti-TNFSF4, CD252 mAb - Research Grade

There are no reviews yet.

Be the first to review “Oxelumab Biosimilar – Anti-TNFSF4, CD252 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products