Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oxelumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Oxelumab ELISA Kit

Oxelumab ELISA Kit

Product name Oxelumab ELISA Kit
Uniprot ID P23510
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX210
Note For research use only.
Sample type Plasma, Serum
Target Oxelumab
Immunogen Oxelumab

Introduction

Oxelumab, also known as MEDI-5872, is a humanized monoclonal antibody that targets the interleukin-6 (IL-6) cytokine. It is currently being investigated as a potential therapeutic agent for various autoimmune and inflammatory diseases. The development and use of Oxelumab ELISA Kit has greatly facilitated the research and clinical application of this antibody. In this article, we will discuss the structure, activity, and application of Oxelumab ELISA Kit.

Structure of Oxelumab

Oxelumab is a recombinant human IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable regions of the heavy and light chains are responsible for binding to IL-6, while the constant regions determine the antibody’s effector functions.

Activity of Oxelumab

Oxelumab specifically binds to IL-6 with high affinity, thereby preventing its interaction with its receptor. IL-6 is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various autoimmune and inflammatory diseases, such as rheumatoid arthritis, systemic lupus erythematosus, and Crohn’s disease. By blocking IL-6, Oxelumab inhibits the downstream inflammatory signaling pathways and reduces the production of other pro-inflammatory cytokines, leading to a decrease in disease activity.

Application of Oxelumab ELISA Kit

The Oxelumab ELISA Kit is a valuable tool for the detection and quantification of Oxelumab in various biological samples, such as serum, plasma, and cell culture supernatants. This kit utilizes the sandwich ELISA technique, where the Oxelumab in the sample is captured by a monoclonal antibody specific to the constant region of the antibody, and then detected by a biotinylated monoclonal antibody specific to the variable region. The amount of Oxelumab present in the sample can be determined by measuring the absorbance at a specific wavelength.

The Oxelumab ELISA Kit has several applications in both research and clinical settings. In research, it is used to monitor the pharmacokinetics of Oxelumab in preclinical and clinical studies. This information is crucial for determining the optimal dosing regimen and evaluating the efficacy of the antibody. Additionally, the kit can be used to measure the levels of Oxelumab in patient samples to assess treatment response and disease progression.

In clinical practice, the Oxelumab ELISA Kit can be used for therapeutic drug monitoring, where the levels of Oxelumab in a patient’s blood are monitored to ensure that they are within the therapeutic range. This is particularly important for biologic therapies like Oxelumab, as individual patient responses can vary, and the optimal dose may need to be adjusted accordingly. Furthermore, the kit can also be used for the diagnosis and management of IL-6-mediated diseases, as the levels of Oxelumab can reflect the degree of IL-6 inhibition and disease activity.

Conclusion

In summary, the development of Oxelumab ELISA Kit has greatly enhanced the research and clinical application of Oxelumab as a potential therapeutic agent for various autoimmune and inflammatory diseases. It is a reliable and sensitive tool for the detection and quantification of Oxelumab in biological samples and has multiple applications in research and clinical practice. As the understanding of IL-6-mediated diseases continues to grow, the use of Oxelumab ELISA Kit will play a crucial role in the development and optimization of Oxelumab as a therapeutic target.

Oxelumab ELISA Kit

There are no reviews yet.

Be the first to review “Oxelumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products