Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tumor-associated calcium signal transducer 2(TACSTD2)

  • PX-P4569-50
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P09758
Molecular weight:
35-45kDa

$250.00

50ug + 250 loyalty points
Met1–Thr274 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tumor-associated calcium signal transducer 2(TACSTD2)

Product name Tumor-associated calcium signal transducer 2(TACSTD2)
Uniprot ID P09758
Uniprot link https://www.uniprot.org/uniprot/P09758
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Molecular weight 35-45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr274
Protein Accession P09758
Spec:Entrez GeneID 4070
Spec:NCBI Gene Aliases EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Spec:SwissProtID Q15658
NCBI Reference P09758
Aliases /Synonyms GA733-1, M1S1, TROP2,Cell surface glycoprotein Trop-2;Membrane component chromosome 1 surface marker 1;Pancreatic carcinoma marker protein GA733-1
Reference PX-P4569
Note For research use only
Molecular Constructor
Met1–Thr274 His
Product name Tumor-associated calcium signal transducer 2(TACSTD2)
Uniprot ID P09758
Uniprot link https://www.uniprot.org/uniprot/P09758
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Molecular weight 35-45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr274
Protein Accession P09758
Spec:Entrez GeneID 4070
Spec:NCBI Gene Aliases EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Spec:SwissProtID Q15658
NCBI Reference P09758
Aliases /Synonyms GA733-1, M1S1, TROP2,Cell surface glycoprotein Trop-2;Membrane component chromosome 1 surface marker 1;Pancreatic carcinoma marker protein GA733-1
Reference PX-P4569
Note For research use only
Molecular Constructor
Met1–Thr274 His

Sacituzumab Biosimilar - Anti-TACSTD2 mAb binds to Tumor-associated calcium signal transducer 2(TACSTD2) in indirect ELISA Assay

Sacituzumab Biosimilar - Anti-TACSTD2 mAb binds to Tumor-associated calcium signal transducer 2(TACSTD2) in indirect ELISA Assay

Immobilized Tumor-associated calcium signal transducer 2(TACSTD2) (cat. No.PX-P4569) at 0.5µg/mL (100µL/well) can bind to Sacituzumab Biosimilar - Anti-TACSTD2 mAb (cat. No.PX-TA1447) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Tumor-associated calcium signal transducer 2(TACSTD2)

There are no reviews yet.

Be the first to review “Tumor-associated calcium signal transducer 2(TACSTD2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products