Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vorsetuzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Vorsetuzumab ELISA Kit

Vorsetuzumab ELISA Kit

Product name Vorsetuzumab ELISA Kit
Uniprot ID P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX222
Note For research use only.
Sample type Plasma, Serum
Target Vorsetuzumab
Immunogen Vorsetuzumab

The Structure and Function of Vorsetuzumab ELISA Kit: A Powerful Tool for Antibody Detection and Therapeutic Targeting

Introduction

Vorsetuzumab is a recombinant humanized monoclonal antibody that has shown promising results in the treatment of various diseases, including cancer. Its specificity and high affinity for its target make it a valuable tool in both research and clinical settings. In order to detect and quantify the levels of Vorsetuzumab in biological samples, a specialized tool known as the Vorsetuzumab ELISA Kit has been developed. This kit provides a reliable and sensitive method for the detection and measurement of Vorsetuzumab, making it an essential component in studying the structure, activity, and application of this important therapeutic antibody.

Structure of Vorsetuzumab

Vorsetuzumab is a recombinant humanized monoclonal antibody that is composed of two heavy chains and two light chains. The heavy chains consist of a constant region and a variable region, while the light chains consist of a constant region and a variable region. The variable regions of both the heavy and light chains are responsible for the specificity of Vorsetuzumab, as they contain the antigen-binding sites that recognize and bind to its target.

The constant regions of Vorsetuzumab are responsible for its effector functions, such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These functions play a crucial role in the therapeutic activity of Vorsetuzumab, as they help to eliminate target cells and promote an immune response against the disease.

Activity of Vorsetuzumab

Vorsetuzumab is a potent inhibitor of a protein called CD33, which is a cell surface receptor that is expressed on myeloid cells. CD33 is involved in cell signaling pathways that promote cell survival and proliferation, making it a potential therapeutic target for diseases such as acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS).

By binding to CD33, Vorsetuzumab blocks its activity and triggers the immune system to attack and destroy the CD33-expressing cells. This mechanism of action has been shown to be effective in preclinical studies and is currently being evaluated in clinical trials for the treatment of AML and MDS.

Application of Vorsetuzumab ELISA Kit

The Vorsetuzumab ELISA Kit is a highly sensitive and specific tool that allows for the detection and quantification of Vorsetuzumab in various biological samples, including serum, plasma, and cell culture supernatant. This kit utilizes the principle of enzyme-linked immunosorbent assay (ELISA) to detect the presence of Vorsetuzumab by measuring the absorbance of a colorimetric reaction.

The Vorsetuzumab ELISA Kit has a wide range of applications, including pharmacokinetic studies, drug development, and clinical monitoring. It can be used to determine the concentration of Vorsetuzumab in patient samples, which can help in assessing the efficacy of treatment and optimizing the dosing regimen.

Furthermore, the Vorsetuzumab ELISA Kit can also be used in research studies to investigate the pharmacodynamics of Vorsetuzumab, such as its binding affinity, stability, and distribution in the body. This information can aid in the development of new and improved therapies targeting CD33 and other diseases.

Conclusion

The Vorsetuzumab ELISA Kit is a powerful and essential tool for the detection and measurement of Vorsetuzumab in biological samples. Its high sensitivity and specificity make it an ideal choice for studying the structure, activity, and application of

Vorsetuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Vorsetuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products