Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Vorsetuzumab Biosimilar – Anti-CD70, TNFSF7 mAb – Research Grade

  • PX-TA1304-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $217.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Vorsetuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade
Vorsetuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade in ELISA Assay
Vorsetuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

Vorsetuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

Product name Vorsetuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade
Uniprot ID P32970
Source CAS 1165740-62-4
Species Humanized
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vorsetuzumab,SGN-70,h1F6,CD70, TNFSF7,anti-CD70, TNFSF7
Reference PX-TA1304
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Vorsetuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade
Uniprot ID P32970
Source CAS 1165740-62-4
Species Humanized
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vorsetuzumab,SGN-70,h1F6,CD70, TNFSF7,anti-CD70, TNFSF7
Reference PX-TA1304
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1304-50
Uniprot ID P32970
Source CAS 1165740-62-4
Species Humanized
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vorsetuzumab,SGN-70,h1F6,CD70, TNFSF7,anti-CD70, TNFSF7
Reference PX-TA1304
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-CD70/TNFSF7[Homo sapiens] (Vorsetuzumab) Monoclonal Antibody

Vorsetuzumab is investigated for the treatment of Renal Cell Carcinoma.

SDS-PAGE for Vorsetuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade

SDS-PAGE for Vorsetuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade

Vorsetuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Vorsetuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade in ELISA Assay

Vorsetuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade in ELISA Assay

Vorsetuzumab Biosimilar - Anti-CD70; TNFSF7 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Vorsetuzumab Biosimilar - Anti-CD70, TNFSF7 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vorsetuzumab Biosimilar – Anti-CD70, TNFSF7 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products