Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Omburtamab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Omburtamab ELISA Kit

Omburtamab ELISA Kit

Product name Omburtamab ELISA Kit
Uniprot ID Q5ZPR3
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX267
Note For research use only.
Sample type Plasma, Serum
Target Omburtamab
Immunogen Omburtamab

Introduction to Omburtamab ELISA Kit

Omburtamab is a monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of neuroblastoma, a type of cancer that affects the nervous system in children. This antibody targets a specific protein called GD2, which is highly expressed on the surface of neuroblastoma cells. The Omburtamab ELISA Kit is a diagnostic tool that measures the levels of this antibody in biological samples, providing valuable information for researchers and clinicians studying the efficacy of this therapeutic agent.

Structure of Omburtamab

Omburtamab is a fully humanized IgG1 monoclonal antibody, meaning that it is derived from human cells and has a structure similar to other antibodies produced by the human immune system. It consists of two heavy chains and two light chains, each containing specific regions that are responsible for binding to the GD2 protein. This binding ability is crucial for the therapeutic activity of Omburtamab, as it allows the antibody to specifically target and bind to GD2-expressing neuroblastoma cells.

Activity of Omburtamab

The primary activity of Omburtamab is its ability to bind to GD2 and trigger an immune response against neuroblastoma cells. When the antibody binds to GD2, it activates the immune system to attack and destroy the cancer cells. This is achieved through a process called antibody-dependent cell-mediated cytotoxicity (ADCC), in which immune cells such as natural killer cells and macrophages are recruited to the site of the cancer cells and release substances that kill them.

In addition to its direct anti-

cancer activity, Omburtamab has also been shown to enhance the effectiveness of other cancer treatments, such as chemotherapy and radiation therapy. This is due to its ability to increase the sensitivity of neuroblastoma cells to these treatments, making them more susceptible to destruction.

Application of Omburtamab ELISA Kit

The Omburtamab ELISA Kit is a valuable tool for researchers and clinicians studying the use of this antibody as a therapeutic agent for neuroblastoma. It allows for the quantification of Omburtamab levels in biological samples, such as blood or tissue, providing important information about its distribution and activity in the body.

One potential application of the Omburtamab ELISA Kit is in clinical trials for the development and evaluation of this antibody as a treatment for neuroblastoma. By measuring the levels of Omburtamab in patients receiving the treatment, researchers can assess its effectiveness and determine the optimal dosage for maximum therapeutic benefit.

Another potential application is in monitoring the response to Omburtamab treatment in patients with neuroblastoma. By regularly measuring Omburtamab levels, clinicians can track the progress of the treatment and make adjustments as needed to ensure the best outcome for the patient.

Conclusion

The Omburtamab ELISA Kit is a valuable tool for studying the structure, activity, and application of this promising therapeutic agent for neuroblastoma. Its ability to measure Omburtamab levels in biological samples provides important insights into the efficacy and response to treatment, ultimately contributing to the development of more effective and targeted therapies for this devastating childhood cancer.

Omburtamab ELISA Kit

There are no reviews yet.

Be the first to review “Omburtamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products