Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Leishmania tropica TSA Recombinant Protein

  • PX-P1165-10
Host species:
Escherichia coli (E.coli)
Origin species:
Leishmania tropica
Uniprot ID:
Q07DU5
Molecular weight:
23,47 kDa

$250.00

+ 250 loyalty points
Full-length Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Leishmania tropica TSA Recombinant Protein

Leishmania tropica TSA Recombinant Protein

Product name Leishmania tropica TSA Recombinant Protein
Uniprot ID Q07DU5
Uniprot link http://www.uniprot.org/uniprot/Q07DU5
Origin species Leishmania tropica
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMSCGNAKINSPAPPFEEVALMPNGSFKKISLSAYKGKWVVLFFYPLDFSFVCPTEIIAFSDNVSRFNEL NCEVLACSMDSEYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMVRQITVNDMPV GRNVEEVLRLLEAFQFVEKHGEVCPANWKKGAPAMKPEPNASVEGYFSKQ
Molecular weight 23,47 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Spec:SwissProtID Q07DU5
NCBI Reference AAZ23601.1
Aliases /Synonyms TSA, Peroxidoxin 2 / Thiol-specific Antioxidant Antigen (TSA)
Reference PX-P1165
Note For research use only
Molecular Constructor
Full-length Yes
Product name Leishmania tropica TSA Recombinant Protein
Uniprot ID Q07DU5
Uniprot link http://www.uniprot.org/uniprot/Q07DU5
Origin species Leishmania tropica
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMSCGNAKINSPAPPFEEVALMPNGSFKKISLSAYKGKWVVLFFYPLDFSFVCPTEIIAFSDNVSRFNEL NCEVLACSMDSEYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMVRQITVNDMPV GRNVEEVLRLLEAFQFVEKHGEVCPANWKKGAPAMKPEPNASVEGYFSKQ
Molecular weight 23,47 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Spec:SwissProtID Q07DU5
NCBI Reference AAZ23601.1
Aliases /Synonyms TSA, Peroxidoxin 2 / Thiol-specific Antioxidant Antigen (TSA)
Reference PX-P1165
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Leishmania tropica TSA Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products