Brand: ProteoGenix

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

PX-P4045-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q7Z7D3
Molecular weight:: 28.73kDa

$250.00

50ug + 250 loyalty points

Partial Yes

size size

50ug $250.00
100ug $500.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

Product name	Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein
Uniprot ID	Q7Z7D3
Uniprot link	http://www.uniprot.org/uniprot/Q7Z7D3
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MASLGQILFWSIISIIIILAGAIAFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGSHHHHHH
Molecular weight	28.73kDa
Protein delivered with Tag?	Yes
Purity estimated	70%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	B7-H4, B7H4, B7S1, B7X, B7h.5, VCTN1, T-cell costimulatory molecule B7x, Immune costimulatory protein B7-H4, VTCN1
Reference	PX-P4045
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein
Uniprot ID	Q7Z7D3
Uniprot link	http://www.uniprot.org/uniprot/Q7Z7D3
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MASLGQILFWSIISIIIILAGAIAFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGSHHHHHH
Molecular weight	28.73kDa
Protein delivered with Tag?	Yes
Purity estimated	70%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	B7-H4, B7H4, B7S1, B7X, B7h.5, VCTN1, T-cell costimulatory molecule B7x, Immune costimulatory protein B7-H4, VTCN1
Reference	PX-P4045
Note	For research use only
Molecular Constructor	Partial Yes

There are no reviews yet.

Be the first to review “Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein”

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

Related products

Alsevalimab Biosimilar – Anti-VTCN1 mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

Specifications Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

Documents

Reviews

Related products

Alsevalimab Biosimilar – Anti-VTCN1 mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein