Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Alsevalimab Biosimilar – Anti-VTCN1 mAb – Research Grade

  • PX-TA1807-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Alsevalimab Biosimilar - Anti-VTCN1 mAb - Research Grade

Product name Alsevalimab Biosimilar - Anti-VTCN1 mAb - Research Grade
Uniprot ID Q7Z7D3
Species Homo Sapiens
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Alsevalimab,,VTCN1,anti-VTCN1
Reference PX-TA1807
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Alsevalimab Biosimilar - Anti-VTCN1 mAb - Research Grade
Uniprot ID Q7Z7D3
Species Homo Sapiens
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Alsevalimab,,VTCN1,anti-VTCN1
Reference PX-TA1807
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1807-50
Uniprot ID Q7Z7D3
Species Homo Sapiens
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Alsevalimab,,VTCN1,anti-VTCN1
Reference PX-TA1807
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Alsevalimab Biosimilar, also known as Anti-VTCN1 mAb, is a research grade monoclonal antibody that has shown promising results in pre-clinical studies for the treatment of various diseases. This antibody targets the VTCN1 protein, which is a therapeutic target for a range of conditions. In this article, we will discuss the structure, activity and potential applications of Alsevalimab Biosimilar.

Structure of Alsevalimab Biosimilar

Alsevalimab Biosimilar is a recombinant humanized monoclonal antibody, meaning that it is produced using recombinant DNA technology and has been modified to have a human-like structure. It has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains, connected by disulfide bonds. The antibody also contains a variable region, responsible for binding to the target protein, and a constant region, which determines the effector functions of the antibody.

Activity of Alsevalimab Biosimilar

Alsevalimab Biosimilar specifically targets the VTCN1 protein, also known as B7-H4 or B7x. This protein is a member of the B7 family of immune checkpoint proteins and is expressed on the surface of various cells, including tumor cells and immune cells. By binding to VTCN1, Alsevalimab Biosimilar blocks its interaction with its receptor, inhibiting the immunosuppressive effects of this protein. This leads to an enhanced anti-tumor immune response and can also modulate immune cell function in various diseases.

In addition to its primary activity of blocking VTCN1, Alsevalimab Biosimilar also has secondary effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These functions can further enhance the antibody’s therapeutic effects by promoting the destruction of target cells.

Potential Applications of Alsevalimab Biosimilar

The primary therapeutic target for Alsevalimab Biosimilar is cancer, particularly solid tumors that overexpress VTCN1. Pre-clinical studies have shown promising results in various cancer types, including breast, lung, and ovarian cancer. In addition, the antibody has also shown potential in the treatment of autoimmune diseases, such as rheumatoid arthritis and lupus, where VTCN1 plays a role in immune dysregulation.

Alsevalimab Biosimilar may also have applications in organ transplantation, as VTCN1 has been implicated in the development of transplant rejection. By blocking VTCN1, the antibody could potentially improve transplant outcomes and reduce the need for immunosuppressive drugs.

Conclusion

In summary, Alsevalimab Biosimilar is a research grade monoclonal antibody that specifically targets the VTCN1 protein. Its humanized structure and multiple effector functions make it a promising candidate for the treatment of various diseases, particularly cancer and autoimmune conditions. Further research and clinical trials are needed to fully understand the potential of this antibody and its role in improving patient outcomes.

SDS-PAGE for Alsevalimab Biosimilar - Anti-VTCN1,B7-H4 mAb - Research Grade

SDS-PAGE for Alsevalimab Biosimilar - Anti-VTCN1,B7-H4 mAb - Research Grade

Alsevalimab Biosimilar - Anti-VTCN1,B7-H4 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

SEC-HPLC of Alsevalimab Biosimilar - Anti-VTCN1;B7-H4 mAb - Research Grade

SEC-HPLC of Alsevalimab Biosimilar - Anti-VTCN1;B7-H4 mAb - Research Grade

Alsevalimab Biosimilar - Anti-VTCN1;B7-H4 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Alsevalimab Biosimilar - Anti-VTCN1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Alsevalimab Biosimilar – Anti-VTCN1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products