Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirvetuximab Biosimilar – Anti-FOLR1 mAb – Research Grade

  • PX-TA1412-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $218.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade

Product name Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Source CAS 1453084-36-0
Species Chimeric
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mirvetuximab,M9346A,FOLR1,anti-FOLR1
Reference PX-TA1412
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Source CAS 1453084-36-0
Species Chimeric
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mirvetuximab,M9346A,FOLR1,anti-FOLR1
Reference PX-TA1412
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1412-50
Uniprot ID P15328
Source CAS 1453084-36-0
Species Chimeric
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mirvetuximab,M9346A,FOLR1,anti-FOLR1
Reference PX-TA1412
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-FOLR1[Homo sapiens] (Mirvetuximab) Monoclonal Antibody

Mirvetuximab is monoclonal antibody that targets folate receptor alpha (FR alpha). It has been used in ADC form to treat cancers.

Mirvetuximab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Mirvetuximab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Immobilized FOLR1 recombinant protein (cat. No.PX-P5197) at 0.5µg/mL (100µL/well) can bind to Mirvetuximab Biosimilar - Anti-FOLR1 mAb (cat. No.PX-TA1412) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SDS-PAGE for Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade

SDS-PAGE for Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade

Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mirvetuximab Biosimilar - Anti-FOLR1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Mirvetuximab Biosimilar – Anti-FOLR1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products